Clone GH14032 Report

Search the DGRC for GH14032

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:140
Well:32
Vector:pOT2
Associated Gene/Transcriptyuri-RI
Protein status:GH14032.pep: gold
Preliminary Size:1108
Sequenced Size:976

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31732 2001-07-04 Blastp of sequenced clone
yuri 2008-04-29 Release 5.5 accounting
yuri 2008-08-15 Release 5.9 accounting
yuri 2008-12-18 5.12 accounting

Clone Sequence Records

GH14032.complete Sequence

976 bp (976 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051476

> GH14032.complete
CCTTAAAGTCATACTCATGTCTAATTACACAAGCTATTCCCTGGCCGACT
AAATCAGCTCTTAGTAAGAAGAACGTGGTAATTACATTTTGAATTGATAT
CATGGCCAGTCGCCAAGCCGGTTTCGTCCTAGACGCCAAGTCCATGGGTC
TGAATCCGTCGAGACCTGCATCATCGCCACCGCCACCACCATCATCTGCC
AGTCAAATGTGTCGGCAAGTGCAGCCAACCGGAACGAGTGCCTCGCATCC
ACATCAAGAATCGACGCTAAAAGCCTCATCTCCTGATCGGTGCACTGCCA
GCACCGAGGCGATGTCCACCGAACATTACCGCTGTCTGATCCAGAAGCTG
CGGGATACCAACGGCGATGCTGGCGATATGAGCTTTGAGCTGAACAGCAT
ATTTCTGAAGCGGCTGGACGAGATTGACTGCCTAGATGAGCACGAGGGTG
ATGACATGCACACTTGCCAGTTGCGTCTGGTCACTTTTCAGGAGTGGGTG
GATTTCCTGCTCCACGTGAACAGCGTGATCCTGGGCAACGTGTCGGACTT
GGAGAAGGAGGCGTACAGCAAGATCGTTGCCTGCTGTCAGTCTGTCCAAG
TGCGACAACAGCATACCCTCGAGGAGAATCGTAGGCTGCGTGAGGACATT
TGTGCGATCATAGAACGCGTGCAGCATTCTCCTCACTGCACCGACTTTGA
TTTCAATGGCATTTCCCTAGAGACACTGACCGTTAATCAATTGCGGGGCG
TGGGAAAGGATCCCGCCCACGCGGAATGCGAGAGCGAGAAGGTAGGCCAT
AGATCCTTGAAGGGAAAAGGCGGCGGTGATTCCAATGTCAAGTGGGACCC
GAAGTCGTCCCACAAGCGCGAGAACTCTAAATGATTGTCTCGCTAACTAA
ATACGTATATTTTGTGCTGCTCTTAATAAAATTTGATATTTTGTTCATCG
ATATTTAAAAAAAAAAAAAAAAAAAA

GH14032.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
yuri-RI 1048 yuri-RI 93..1048 1..956 4780 100 Plus
yuri.c 3136 yuri.c 464..1254 1..791 3955 100 Plus
yuri-RB 3399 yuri-RB 480..1270 1..791 3955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15261901..15262399 956..458 2495 100 Minus
chr2L 23010047 chr2L 15262504..15262961 458..1 2260 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:50:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15263165..15263665 958..458 2505 100 Minus
2L 23513712 2L 15263770..15264227 458..1 2290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15263165..15263665 958..458 2505 100 Minus
2L 23513712 2L 15263770..15264227 458..1 2290 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:31:04 has no hits.

GH14032.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:32:06 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15261901..15262398 459..956 100 <- Minus
chr2L 15262504..15262961 1..458 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:41:24 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RC 1..700 102..803 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:26:55 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 1..783 102..884 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:31:26 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 1..783 102..884 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:00:07 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RC 1..700 102..803 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:50 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 1..783 102..884 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:26:07 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RC 464..1264 1..803 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:26:55 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 1..956 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:31:26 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 1..956 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:00:07 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RC 464..1264 1..803 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:50 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
yuri-RI 1..956 1..956 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:06 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15263167..15263664 459..956 100 <- Minus
2L 15263770..15264227 1..458 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:06 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15263167..15263664 459..956 100 <- Minus
2L 15263770..15264227 1..458 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:06 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15263167..15263664 459..956 100 <- Minus
2L 15263770..15264227 1..458 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:31:26 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15263167..15263664 459..956 100 <- Minus
arm_2L 15263770..15264227 1..458 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:37:57 Download gff for GH14032.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15263167..15263664 459..956 100 <- Minus
2L 15263770..15264227 1..458 100   Minus

GH14032.hyp Sequence

Translation from 101 to 883

> GH14032.hyp
MASRQAGFVLDAKSMGLNPSRPASSPPPPPSSASQMCRQVQPTGTSASHP
HQESTLKASSPDRCTASTEAMSTEHYRCLIQKLRDTNGDAGDMSFELNSI
FLKRLDEIDCLDEHEGDDMHTCQLRLVTFQEWVDFLLHVNSVILGNVSDL
EKEAYSKIVACCQSVQVRQQHTLEENRRLREDICAIIERVQHSPHCTDFD
FNGISLETLTVNQLRGVGKDPAHAECESEKVGHRSLKGKGGGDSNVKWDP
KSSHKRENSK*

GH14032.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
yuri-PI 260 CG31732-PI 1..260 1..260 1379 100 Plus
yuri-PC 578 CG31732-PC 1..241 1..239 1217 96.7 Plus
yuri-PB 890 CG31732-PB 1..241 1..239 1217 96.7 Plus
yuri-PQ 981 CG31732-PQ 1..241 1..239 1217 96.7 Plus
yuri-PD 564 CG31732-PD 1..227 15..239 1151 96.5 Plus

GH14032.pep Sequence

Translation from 101 to 883

> GH14032.pep
MASRQAGFVLDAKSMGLNPSRPASSPPPPPSSASQMCRQVQPTGTSASHP
HQESTLKASSPDRCTASTEAMSTEHYRCLIQKLRDTNGDAGDMSFELNSI
FLKRLDEIDCLDEHEGDDMHTCQLRLVTFQEWVDFLLHVNSVILGNVSDL
EKEAYSKIVACCQSVQVRQQHTLEENRRLREDICAIIERVQHSPHCTDFD
FNGISLETLTVNQLRGVGKDPAHAECESEKVGHRSLKGKGGGDSNVKWDP
KSSHKRENSK*

GH14032.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14532-PA 956 GF14532-PA 1..240 1..233 613 53.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24217-PA 1056 GG24217-PA 1..231 1..231 840 76.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13126-PA 1007 GH13126-PA 26..255 11..230 409 40.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
yuri-PI 260 CG31732-PI 1..260 1..260 1379 100 Plus
yuri-PC 578 CG31732-PC 1..241 1..239 1217 96.7 Plus
yuri-PB 890 CG31732-PB 1..241 1..239 1217 96.7 Plus
yuri-PS 564 CG31732-PS 1..227 15..239 1151 96.5 Plus
yuri-PD 564 CG31732-PD 1..227 15..239 1151 96.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22737-PA 1052 GI22737-PA 134..306 72..242 448 53.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26602-PA 953 GL26602-PA 53..222 64..232 373 44.8 Plus
Dper\GL25376-PA 253 GL25376-PA 1..240 1..240 341 36.8 Plus
Dper\GL15146-PA 103 GL15146-PA 12..94 91..177 245 52.9 Plus
Dper\GL18313-PA 149 GL18313-PA 19..115 124..223 226 44.6 Plus
Dper\GL22379-PA 92 GL22379-PA 1..89 143..235 211 47.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24009-PA 259 GA24009-PA 6..246 7..240 420 39.2 Plus
Dpse\GA16430-PA 953 GA16430-PA 53..222 64..232 377 44.8 Plus
Dpse\GA27457-PA 175 GA27457-PA 2..95 124..223 200 44.6 Plus
Dpse\GA27906-PA 208 GA27906-PA 17..139 64..220 179 36.3 Plus
Dpse\GA22900-PA 94 GA22900-PA 1..66 143..208 178 51.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14489-PA 1065 GM14489-PA 1..244 1..242 1053 86.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21966-PA 926 GD21966-PA 1..241 1..239 1055 88.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23299-PA 1054 GJ23299-PA 113..279 66..231 489 59.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18260-PA 951 GK18260-PA 106..276 63..232 475 53.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19411-PA 890 GE19411-PA 1..255 1..255 825 69.6 Plus