Clone GH14143 Report

Search the DGRC for GH14143

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:141
Well:43
Vector:pOT2
Associated Gene/Transcriptv-RA
Protein status:GH14143.pep: gold
Preliminary Size:1806
Sequenced Size:1306

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2155 2001-01-01 Release 2 assignment
CG2155 2001-07-04 Blastp of sequenced clone
CG2155 2003-01-01 Sim4 clustering to Release 3
v 2008-04-29 Release 5.5 accounting
v 2008-08-15 Release 5.9 accounting
v 2008-12-18 5.12 accounting

Clone Sequence Records

GH14143.complete Sequence

1306 bp (1306 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051478

> GH14143.complete
CCGCTCGAGGAGTCACGATCTGATCTGAGCTGTGCACCATGAGCTGTCCC
TATGCAGGAAACGGAAACGATCACGATGATTCGGCGGTGCCATTAACCAC
GGAAGTGGGCAAAATCTATGGAGAGTATCTGATGCTGGACAAACTGCTGG
ATGCCCAGTGTATGCTCTCCGAGGAGGACAAGCGACCCGTGCACGATGAG
CATCTGTTCATCATCACGCACCAGGCCTACGAGCTTTGGTTCAAGCAGAT
CATCTTTGAGTTCGACTCCATACGAGACATGTTGGATGCAGAGGTCATCG
ATGAAACCAAGACGCTGGAGATTGTCAAGCGACTGAACCGAGTGGTTCTG
ATTCTAAAACTCCTGGTGGACCAAGTGCCCATTCTGGAGACCATGACCCC
GCTTGACTTCATGGACTTCCGCAAGTACCTGGCACCCGCATCTGGTTTCC
AGTCGCTGCAGTTCCGTTTGATCGAGAACAAGCTGGGAGTTCTGACAGAG
CAGCGGGTGAGATACAACCAGAAGTACTCGGATGTCTTTAGCGACGAGGA
GGCGCGGAATTCGATTCGCAACTCGGAGAAAGATCCCTCGCTACTGGAGC
TAGTGCAGCGATGGCTGGAGAGGACGCCCGGACTGGAGGAGAGTGGCTTC
AACTTCTGGGCCAAGTTTCAGGAGAGCGTCGATCGATTCCTGGAGGCGCA
GGTACAGAGCGCCATGGAGGAGCCCGTGGAGAAGGCGAAAAACTACCGCC
TCATGGACATTGAGAAGCGACGCGAGGTGTATCGCTCCATCTTTGATCCG
GCAGTGCACGATGCACTGGTGCGACGTGGGGATCGCCGGTTTAGCCATCG
TGCCCTCCAGGGAGCCATCATGATCACCTTCTATAGGGATGAACCCAGAT
TCAGCCAGCCACACCAGTTGCTCACCCTGCTCATGGACATCGACTCGTTA
ATAACCAAGTGGAGATACAATCACGTGATCATGGTGCAACGCATGATTGG
ATCCCAACAGTTGGGCACTGGTGGCTCGTCTGGATATCAATATCTGCGCT
CCACTCTCAGTGATCGGTACAAGGTGTTTCTGGATCTGTTCAATCTGTCC
ACTTTTCTGATTCCCCGCGAGGCGATTCCACCGCTGGACGAGACCATTCG
CAAGAAACTGATCAACAAAAGTGTCTGACAATCGGCAGGGTATCCAATTG
GTCAATGTTTGGCTATGCGTTGTTTGTTCTGCCTACTGTTTTGTCGTTTT
GGTGTAATAAAATTACTTGTTTAGTCTTTGTTATCACAAAAAAAAAAAAA
AAAAAA

GH14143.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
v-RA 1529 v-RA 173..1460 1..1288 6440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10815838..10816444 360..966 2945 99 Plus
chrX 22417052 chrX 10816702..10816932 1057..1287 1155 100 Plus
chrX 22417052 chrX 10815428..10815589 64..225 795 99.4 Plus
chrX 22417052 chrX 10815649..10815783 225..359 675 100 Plus
chrX 22417052 chrX 10816536..10816629 967..1060 470 100 Plus
chrX 22417052 chrX 10815292..10815355 1..64 320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:50:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10924536..10925142 360..966 3035 100 Plus
X 23542271 X 10925401..10925632 1057..1288 1160 100 Plus
X 23542271 X 10924126..10924287 64..225 810 100 Plus
X 23542271 X 10924347..10924481 225..359 675 100 Plus
X 23542271 X 10925234..10925327 967..1060 470 100 Plus
X 23542271 X 10923990..10924053 1..64 320 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10932634..10933240 360..966 3035 100 Plus
X 23527363 X 10933499..10933730 1057..1288 1160 100 Plus
X 23527363 X 10932224..10932385 64..225 810 100 Plus
X 23527363 X 10932445..10932579 225..359 675 100 Plus
X 23527363 X 10933332..10933425 967..1060 470 100 Plus
X 23527363 X 10932088..10932151 1..64 320 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:57:09 has no hits.

GH14143.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:57:52 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10815650..10815783 226..359 100 -> Plus
chrX 10815292..10815355 1..64 100 -> Plus
chrX 10815429..10815589 65..225 99 -> Plus
chrX 10815838..10816444 360..966 99 -> Plus
chrX 10816536..10816629 967..1060 100 -> Plus
chrX 10816706..10816932 1061..1287 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:41:52 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1140 39..1178 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:59:54 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1140 39..1178 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:02:50 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1140 39..1178 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:43:49 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1140 39..1178 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:58 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1140 39..1178 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:15:09 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1287 1..1287 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:59:54 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1287 1..1287 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:02:50 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 19..1305 1..1287 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:43:49 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 1..1287 1..1287 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:58 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
v-RA 19..1305 1..1287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:52 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
X 10924127..10924287 65..225 100 -> Plus
X 10924348..10924481 226..359 100 -> Plus
X 10923990..10924053 1..64 100 -> Plus
X 10924536..10925142 360..966 100 -> Plus
X 10925234..10925327 967..1060 100 -> Plus
X 10925405..10925631 1061..1287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:52 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
X 10924127..10924287 65..225 100 -> Plus
X 10924348..10924481 226..359 100 -> Plus
X 10923990..10924053 1..64 100 -> Plus
X 10924536..10925142 360..966 100 -> Plus
X 10925234..10925327 967..1060 100 -> Plus
X 10925405..10925631 1061..1287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:57:52 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
X 10924127..10924287 65..225 100 -> Plus
X 10924348..10924481 226..359 100 -> Plus
X 10923990..10924053 1..64 100 -> Plus
X 10924536..10925142 360..966 100 -> Plus
X 10925234..10925327 967..1060 100 -> Plus
X 10925405..10925631 1061..1287 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:02:50 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10818023..10818086 1..64 100 -> Plus
arm_X 10818160..10818320 65..225 100 -> Plus
arm_X 10818381..10818514 226..359 100 -> Plus
arm_X 10818569..10819175 360..966 100 -> Plus
arm_X 10819267..10819360 967..1060 100 -> Plus
arm_X 10819438..10819664 1061..1287 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:26:43 Download gff for GH14143.complete
Subject Subject Range Query Range Percent Splice Strand
X 10932634..10933240 360..966 100 -> Plus
X 10933332..10933425 967..1060 100 -> Plus
X 10933503..10933729 1061..1287 100   Plus
X 10932088..10932151 1..64 100 -> Plus
X 10932225..10932385 65..225 100 -> Plus
X 10932446..10932579 226..359 100 -> Plus

GH14143.pep Sequence

Translation from 38 to 1177

> GH14143.pep
MSCPYAGNGNDHDDSAVPLTTEVGKIYGEYLMLDKLLDAQCMLSEEDKRP
VHDEHLFIITHQAYELWFKQIIFEFDSIRDMLDAEVIDETKTLEIVKRLN
RVVLILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLIENKLG
VLTEQRVRYNQKYSDVFSDEEARNSIRNSEKDPSLLELVQRWLERTPGLE
ESGFNFWAKFQESVDRFLEAQVQSAMEEPVEKAKNYRLMDIEKRREVYRS
IFDPAVHDALVRRGDRRFSHRALQGAIMITFYRDEPRFSQPHQLLTLLMD
IDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDL
FNLSTFLIPREAIPPLDETIRKKLINKSV*

GH14143.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\v-PA 380 GF20476-PA 1..380 1..379 1929 95 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18380-PA 379 GG18380-PA 1..379 1..379 2000 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12679-PA 377 GH12679-PA 1..377 1..376 1840 91.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:38
Subject Length Description Subject Range Query Range Score Percent Strand
v-PA 379 CG2155-PA 1..379 1..379 1950 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16256-PA 380 GI16256-PA 1..380 1..379 1878 92.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18243-PA 380 GL18243-PA 1..380 1..379 1903 93.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15272-PA 380 GA15272-PA 1..380 1..379 1903 93.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11443-PA 379 GM11443-PA 1..379 1..379 2017 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\v-PA 379 GD16993-PA 1..379 1..379 2017 99.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16721-PA 358 GJ16721-PA 1..358 1..379 1731 87.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19977-PA 380 GK19977-PA 1..380 1..379 1901 92.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\v-PA 379 GE15897-PA 1..379 1..379 2004 99.2 Plus

GH14143.hyp Sequence

Translation from 38 to 1177

> GH14143.hyp
MSCPYAGNGNDHDDSAVPLTTEVGKIYGEYLMLDKLLDAQCMLSEEDKRP
VHDEHLFIITHQAYELWFKQIIFEFDSIRDMLDAEVIDETKTLEIVKRLN
RVVLILKLLVDQVPILETMTPLDFMDFRKYLAPASGFQSLQFRLIENKLG
VLTEQRVRYNQKYSDVFSDEEARNSIRNSEKDPSLLELVQRWLERTPGLE
ESGFNFWAKFQESVDRFLEAQVQSAMEEPVEKAKNYRLMDIEKRREVYRS
IFDPAVHDALVRRGDRRFSHRALQGAIMITFYRDEPRFSQPHQLLTLLMD
IDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDL
FNLSTFLIPREAIPPLDETIRKKLINKSV*

GH14143.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
v-PA 379 CG2155-PA 1..379 1..379 1950 100 Plus