Clone GH14327 Report

Search the DGRC for GH14327

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:143
Well:27
Vector:pOT2
Associated Gene/TranscriptBI-1-RA
Protein status:GH14327.pep: gold
Preliminary Size:1085
Sequenced Size:1102

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7188 2001-01-01 Release 2 assignment
CG7188 2001-09-19 Blastp of sequenced clone
CG7188 2003-01-01 Sim4 clustering to Release 3
CG7188 2008-04-29 Release 5.5 accounting
CG7188 2008-08-15 Release 5.9 accounting
CG7188 2008-12-18 5.12 accounting

Clone Sequence Records

GH14327.complete Sequence

1102 bp (1102 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058377

> GH14327.complete
AAAAGGCAAGAAAATAGAGCCGAGTAGGCCTTACAAAGTAAACAGTCAGT
TTTAAAACATCAGTGCAAACAGTTCTAATTCACTCCTCCGTTTGACAAAC
TTATGTGTAATATTACTGGAAACTAGCAAGAGCAAGTGCGAAAAAGACTA
CAATGGCAGATACTGCGAATTACATCAACGACCGTTTCCAGACCTTCATG
AACGGGCTCGGTGACCGTTATGAGCCCTATGTGCGCGAGCACCTGTCTAA
GGTTTACATGGTCCTGGGCAGCACTGCCGCTGCCACGGCCATGGGAGCCA
TGCTTCAGATGCGTGACTTTCTCGATCTTGGAGTCCTGGCGGCGGTGGCC
ACTCTAGTCCTGGTCTTGGGTCTGCACTTCTACAAGGATGACGGCAAGAA
CTATTATACACGTTTGGGCATGCTCTACGCCTTCGGATTCTGCTCCGGCC
AGACGCTCGGACCGCTCCTCGGCTATATATGCAGCATAAATCCGGCAATA
ATCCTGTCTGCCCTTACGGGCACCTTCGTCACCTTCATCTCGCTCTCCTT
GTCCGCCCTTCTGGCCGAGCAGGGCAAGTACCTCTATCTGGGTGGGATGC
TGGTTAGCGTCATCAACACCATGGCGCTGCTGAGTCTCTTTAACATGGTC
TTCAAGTCCTACTTCGTGCAAGTGACTCAACTTTACGTCGGCGTTTTCGT
TATGGCTGCCTTCATCGTCTACGATACACAGAACATTGTGGAGAAGTGCC
GAAACGGAAATCGAGATGTGGTGCAGCACGCTTTAGATTTGTTCTTCGAT
GTACTCAGCATGTTCCGCCGTTTGCTGATTATACTGACGCAAAAGGAGGA
GCGAAAACAGAATGAACGCCGCCAGAACAAAACTAAATAAACTTTTATGT
GTAACAGCCACCACAAGAAAAACATCTGACACGGATTTTGGAGGCAGATT
TCTCATTCTAGAAAATTATTCGCATTGAATATTAATAATGCCGTGTACAT
TTGGCTTTAAATTTACAGACATATATATCCAATATAAAACCCATGAAATT
TTTCCATTTAATAAACACCACAAGAAGTAATAAAAAAAAAAAAAAAAAAA
AA

GH14327.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7188-RA 1292 CG7188-RA 159..1238 1..1080 5400 100 Plus
CG7188-RB 1397 CG7188-RB 124..968 1..845 4225 100 Plus
CG7188-RB 1397 CG7188-RB 1104..1343 841..1080 1185 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8300113..8300566 674..221 2270 100 Minus
chr3L 24539361 chr3L 8300717..8300936 220..1 1100 100 Minus
chr3L 24539361 chr3L 8299157..8299397 1080..844 1095 97.9 Minus
chr3L 24539361 chr3L 8299808..8299980 846..674 835 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:51:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8308092..8308545 674..221 2270 100 Minus
3L 28110227 3L 8307146..8307382 1080..844 1185 100 Minus
3L 28110227 3L 8308696..8308915 220..1 1100 100 Minus
3L 28110227 3L 8307793..8307965 846..674 865 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8301192..8301645 674..221 2270 100 Minus
3L 28103327 3L 8300246..8300482 1080..844 1185 100 Minus
3L 28103327 3L 8301796..8302015 220..1 1100 100 Minus
3L 28103327 3L 8300893..8301065 846..674 865 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:42:32 has no hits.

GH14327.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:43:46 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8300717..8300936 1..220 100   Minus
chr3L 8299156..8299395 846..1081 97 <- Minus
chr3L 8299809..8299979 675..845 98 <- Minus
chr3L 8300113..8300566 221..674 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:42:16 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
CG7188-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:58:41 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
CG7188-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:29 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
BI-1-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:41:53 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
CG7188-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:54 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
BI-1-RA 1..738 153..890 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:13:20 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
CG7188-RA 48..1127 1..1081 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:58:41 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
CG7188-RA 66..1145 1..1081 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:29 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
BI-1-RA 27..1106 1..1081 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:41:53 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
CG7188-RA 48..1127 1..1081 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:54 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
BI-1-RA 27..1106 1..1081 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:46 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8307145..8307380 846..1081 99 <- Minus
3L 8307794..8307964 675..845 100 <- Minus
3L 8308092..8308545 221..674 100 <- Minus
3L 8308696..8308915 1..220 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:46 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8307145..8307380 846..1081 99 <- Minus
3L 8307794..8307964 675..845 100 <- Minus
3L 8308092..8308545 221..674 100 <- Minus
3L 8308696..8308915 1..220 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:46 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8307145..8307380 846..1081 99 <- Minus
3L 8307794..8307964 675..845 100 <- Minus
3L 8308092..8308545 221..674 100 <- Minus
3L 8308696..8308915 1..220 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:29 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8300245..8300480 846..1081 99 <- Minus
arm_3L 8300894..8301064 675..845 100 <- Minus
arm_3L 8301192..8301645 221..674 100 <- Minus
arm_3L 8301796..8302015 1..220 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:25:06 Download gff for GH14327.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8300894..8301064 675..845 100 <- Minus
3L 8300245..8300480 846..1081 99 <- Minus
3L 8301192..8301645 221..674 100 <- Minus
3L 8301796..8302015 1..220 100   Minus

GH14327.hyp Sequence

Translation from 152 to 889

> GH14327.hyp
MADTANYINDRFQTFMNGLGDRYEPYVREHLSKVYMVLGSTAAATAMGAM
LQMRDFLDLGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLYAFGFCSGQ
TLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGML
VSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCR
NGNRDVVQHALDLFFDVLSMFRRLLIILTQKEERKQNERRQNKTK*

GH14327.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
BI-1-PA 245 CG7188-PA 1..245 1..245 1239 100 Plus
BI-1-PB 237 CG7188-PB 1..231 1..231 1167 100 Plus
CG1287-PA 365 CG1287-PA 139..364 26..235 166 27.3 Plus

GH14327.pep Sequence

Translation from 152 to 889

> GH14327.pep
MADTANYINDRFQTFMNGLGDRYEPYVREHLSKVYMVLGSTAAATAMGAM
LQMRDFLDLGVLAAVATLVLVLGLHFYKDDGKNYYTRLGMLYAFGFCSGQ
TLGPLLGYICSINPAIILSALTGTFVTFISLSLSALLAEQGKYLYLGGML
VSVINTMALLSLFNMVFKSYFVQVTQLYVGVFVMAAFIVYDTQNIVEKCR
NGNRDVVQHALDLFFDVLSMFRRLLIILTQKEERKQNERRQNKTK*

GH14327.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23562-PA 243 GF23562-PA 1..241 1..241 1175 92.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15091-PA 243 GG15091-PA 1..241 1..241 1245 97.9 Plus
Dere\GG25161-PA 365 GG25161-PA 136..364 23..235 162 27.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15378-PA 243 GH15378-PA 1..243 1..243 1111 85.6 Plus
Dgri\GH18310-PA 366 GH18310-PA 137..366 23..236 167 27.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
BI-1-PA 245 CG7188-PA 1..245 1..245 1239 100 Plus
BI-1-PB 237 CG7188-PB 1..231 1..231 1167 100 Plus
Mics1-PA 365 CG1287-PA 139..364 26..235 166 27.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12982-PA 244 GI12982-PA 1..243 1..243 1121 85.6 Plus
Dmoj\GI24122-PA 367 GI24122-PA 137..367 23..237 159 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22552-PA 244 GL22552-PA 3..242 2..241 1077 87.9 Plus
Dper\GL22313-PA 244 GL22313-PA 5..241 4..240 916 78.9 Plus
Dper\GL15216-PA 236 GL15216-PA 3..234 2..233 769 68.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24652-PA 244 GA24652-PA 3..242 2..241 1077 87.9 Plus
Dpse\GA27449-PA 244 GA27449-PA 5..241 4..240 928 79.7 Plus
Dpse\GA22910-PA 236 GA22910-PA 3..234 2..233 766 68.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24950-PA 87 GM24950-PA 1..83 1..83 407 92.8 Plus
Dsec\GM24951-PA 64 GM24951-PA 2..58 175..231 297 100 Plus
Dsec\GM10478-PA 365 GM10478-PA 136..364 23..235 157 27.4 Plus
Dsec\GM11453-PA 341 GM11453-PA 113..341 23..235 144 26.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13001-PA 244 GD13001-PA 1..243 1..243 1236 96.7 Plus
Dsim\GD19479-PA 365 GD19479-PA 136..364 23..235 157 27.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13126-PA 237 GJ13126-PA 1..231 1..231 1076 87.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16998-PA 244 GK16998-PA 1..242 1..241 1151 90.1 Plus
Dwil\GK12014-PA 361 GK12014-PA 131..361 23..235 162 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21316-PA 243 GE21316-PA 1..241 1..241 1248 98.3 Plus
Dyak\GE25789-PA 365 GE25789-PA 136..364 23..235 162 27.4 Plus
Dyak\GE15904-PA 339 GE15904-PA 113..339 23..235 149 26.3 Plus