Clone GH14476 Report

Search the DGRC for GH14476

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:144
Well:76
Vector:pOT2
Associated Gene/TranscriptCG3565-RA
Protein status:GH14476.pep: gold
Preliminary Size:987
Sequenced Size:881

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3565 2001-01-01 Release 2 assignment
CG3565 2002-06-07 Blastp of sequenced clone
CG3565 2003-01-01 Sim4 clustering to Release 3
CG3565 2008-04-29 Release 5.5 accounting
CG3565 2008-08-15 Release 5.9 accounting
CG3565 2008-12-18 5.12 accounting

Clone Sequence Records

GH14476.complete Sequence

881 bp (881 high quality bases) assembled on 2002-06-07

GenBank Submission: AY119517

> GH14476.complete
ATAAATCGAAATGAAGGACCTGGACGGCTCCTTGGACACTCTGGAGAATG
CCCGCTTCAACTACGTGTATATGAAGGACATTGCTCGCCTGGCAAAGGAC
TCGATCTTCTCGCATAACGAGCTGATTAGCATTGTAATGCTCTACCATAA
GTTTGTGCTGGTCAATGGGCCGAGAGCAAAGTACATGACCATTCAGCAAC
TCTCTGCGCTGATGGAGCTCTTGTTTGAGATCGTGGATCGCGATCTCATT
GCGACCATTGTGTATAGAATAGCCCATACACCAGGTTCCAGGCCTCCTGA
CTTCTTTTCCGACAAGCATATACACTTGGAGTCCTTTGTGCGGCTTTTCA
CCGTATACTTCACCAAAGATCTTCAGCTGAAAATGGAATTCGCATTCTCG
GTCTACGATAAAAGCGATTCCAAGCAGTTGAATGGCGAGCAAGTTGGGTT
CTTCGTCGGCAAGTTCTTTGAGAGCGAGGATGAAGACGAATCCATTGAGC
TGCGCTTGGACATGAAGGAGATGCTGTTCCTCAAATTCGACTTGGACAAG
GATACCAACATTGGGGTTGATGAGTACTACGAGGTGGTCCGCCGACAGCC
CATGCTGCTGGAGTGCTTTGGTCGCGTGTTTCCCCCGAATCCCCAGATGG
AGGTCCTTGCGCTGTGCGCCAATGTAATGTCTTGGTTTGACGATTCGCCC
AATCCCAGGATTATGATAAAACCAGACGGCGGCAAGGCCAGCTAGCTAAC
AGGACGTCCAGGAACGCATTTTTATCTAACCAGATACTTAAATTGTGACA
CGTCTAGAAATTGAAAAGTGCAAATAATTTAGTGCATCATAAAGGTTTAC
ACTTTTATTAAAAAAAAAAAAAAAAAAAAAA

GH14476.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3565-RA 961 CG3565-RA 103..961 1..859 4295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20488385..20488786 1..402 2010 100 Plus
chr2R 21145070 chr2R 20489010..20489335 508..833 1630 100 Plus
chr2R 21145070 chr2R 20488841..20488950 400..509 505 97.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24602512..24602913 1..402 2010 100 Plus
2R 25286936 2R 24603137..24603490 508..861 1770 100 Plus
2R 25286936 2R 24602968..24603077 400..509 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24603711..24604112 1..402 2010 100 Plus
2R 25260384 2R 24604336..24604689 508..861 1770 100 Plus
2R 25260384 2R 24604167..24604276 400..509 550 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:01:10 has no hits.

GH14476.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:02:08 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20489011..20489333 509..831 100 -> Plus
chr2R 20489348..20489374 832..859 96   Plus
chr2R 20488385..20488784 1..400 100 -> Plus
chr2R 20488842..20488949 401..508 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:42:45 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 1..735 11..745 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:51:25 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 1..735 11..745 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:23:58 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 1..735 11..745 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:33:40 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 1..735 11..745 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:10 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 1..735 11..745 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:02:41 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 41..899 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:51:24 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 41..899 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:58 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 41..899 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:33:40 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 41..899 1..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:10 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
CG3565-RA 41..899 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:02:08 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24602512..24602911 1..400 100 -> Plus
2R 24602969..24603076 401..508 100 -> Plus
2R 24603138..24603488 509..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:02:08 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24602512..24602911 1..400 100 -> Plus
2R 24602969..24603076 401..508 100 -> Plus
2R 24603138..24603488 509..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:02:08 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24602512..24602911 1..400 100 -> Plus
2R 24602969..24603076 401..508 100 -> Plus
2R 24603138..24603488 509..859 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:58 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20490035..20490434 1..400 100 -> Plus
arm_2R 20490492..20490599 401..508 100 -> Plus
arm_2R 20490661..20491011 509..859 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:14:39 Download gff for GH14476.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24603729..24604128 1..400 100 -> Plus
2R 24604186..24604293 401..508 100 -> Plus
2R 24604355..24604705 509..859 100   Plus

GH14476.hyp Sequence

Translation from 10 to 744

> GH14476.hyp
MKDLDGSLDTLENARFNYVYMKDIARLAKDSIFSHNELISIVMLYHKFVL
VNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIAHTPGSRPPDFFS
DKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFVG
KFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLL
ECFGRVFPPNPQMEVLALCANVMSWFDDSPNPRIMIKPDGGKAS*

GH14476.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG3565-PA 244 CG3565-PA 1..244 1..244 1266 100 Plus
sowi-PA 217 CG15178-PA 1..212 1..222 374 36 Plus
CG15177-PA 225 CG15177-PA 1..215 1..224 358 36.4 Plus
sunz-PA 220 CG15179-PA 1..214 1..226 356 37.6 Plus
CG15177-PB 217 CG15177-PB 1..207 1..224 324 35.1 Plus

GH14476.pep Sequence

Translation from 10 to 744

> GH14476.pep
MKDLDGSLDTLENARFNYVYMKDIARLAKDSIFSHNELISIVMLYHKFVL
VNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYRIAHTPGSRPPDFFS
DKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFVG
KFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLL
ECFGRVFPPNPQMEVLALCANVMSWFDDSPNPRIMIKPDGGKAS*

GH14476.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11793-PA 253 GF11793-PA 3..244 4..243 756 59.9 Plus
Dana\GF16646-PA 222 GF16646-PA 1..211 1..221 380 37.6 Plus
Dana\GF16647-PA 221 GF16647-PA 1..211 1..221 357 35.1 Plus
Dana\GF16917-PA 218 GF16917-PA 3..215 4..228 341 38.2 Plus
Dana\GF18370-PA 218 GF18370-PA 1..214 1..226 339 35 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22989-PA 244 GG22989-PA 1..244 1..244 1205 92.2 Plus
Dere\GG10380-PA 217 GG10380-PA 1..212 1..222 369 35.6 Plus
Dere\GG13568-PA 220 GG13568-PA 1..214 1..226 362 37.6 Plus
Dere\GG10369-PA 225 GG10369-PA 1..215 1..224 352 36.4 Plus
Dere\GG19247-PA 219 GG19247-PA 3..211 4..224 306 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20009-PA 263 GH20009-PA 1..198 1..200 490 49.5 Plus
Dgri\GH15665-PA 218 GH15665-PA 1..216 1..231 395 37.2 Plus
Dgri\GH20009-PA 263 GH20009-PA 205..263 31..89 150 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG3565-PA 244 CG3565-PA 1..244 1..244 1266 100 Plus
sowi-PA 217 CG15178-PA 1..212 1..222 374 36 Plus
CG15177-PA 225 CG15177-PA 1..215 1..224 358 36.4 Plus
sunz-PA 220 CG15179-PA 1..214 1..226 356 37.6 Plus
CG15177-PB 217 CG15177-PB 1..207 1..224 324 35.1 Plus
d-cup-PA 219 CG14387-PA 3..211 4..224 323 36.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19190-PA 221 GI19190-PA 1..220 1..222 558 49.1 Plus
Dmoj\GI22488-PA 220 GI22488-PA 1..216 1..226 399 38.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10228-PA 234 GL10228-PA 1..226 1..226 660 54.9 Plus
Dper\GL21763-PA 220 GL21763-PA 1..216 1..226 382 37.2 Plus
Dper\GL22057-PA 224 GL22057-PA 1..215 1..225 382 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17523-PA 234 GA17523-PA 1..226 1..226 658 54.9 Plus
Dpse\GA13552-PA 220 GA13552-PA 1..216 1..226 382 37.2 Plus
Dpse\GA13550-PA 224 GA13550-PA 1..215 1..225 382 37.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11883-PA 244 GM11883-PA 1..244 1..244 1282 98.4 Plus
Dsec\GM10541-PA 217 GM10541-PA 1..212 1..222 366 35.6 Plus
Dsec\GM10540-PA 225 GM10540-PA 1..215 1..224 358 36.4 Plus
Dsec\GM10904-PA 220 GM10904-PA 1..214 1..226 356 37.2 Plus
Dsec\GM24064-PA 219 GM24064-PA 3..211 4..224 315 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11881-PA 244 GD11881-PA 1..244 1..244 1283 98.8 Plus
Dsim\GD19538-PA 225 GD19538-PA 1..215 1..224 358 36.4 Plus
Dsim\GD19539-PA 233 GD19539-PA 1..206 1..215 344 35.6 Plus
Dsim\GD19884-PA 197 GD19884-PA 1..196 1..208 320 37.5 Plus
Dsim\GD18861-PA 219 GD18861-PA 3..211 4..224 315 35.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20255-PA 224 GJ20255-PA 1..224 1..224 583 50 Plus
Dvir\GJ10087-PA 158 GJ10087-PA 1..155 1..165 262 34.5 Plus
Dvir\GJ23423-PA 63 GJ23423-PA 1..59 168..226 153 47.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11523-PA 219 GK11523-PA 1..219 1..229 373 36.2 Plus
Dwil\GK11579-PA 214 GK11579-PA 1..198 1..208 370 39.4 Plus
Dwil\GK22790-PA 222 GK22790-PA 3..219 4..227 314 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14426-PA 244 GE14426-PA 1..244 1..244 1186 95.1 Plus
Dyak\GE10232-PA 220 GE10232-PA 1..214 1..226 377 38.9 Plus
Dyak\GE24093-PA 225 GE24093-PA 1..215 1..224 360 36.4 Plus
Dyak\GE24094-PA 207 GE24094-PA 1..202 11..222 344 35.8 Plus
Dyak\GE26222-PA 219 GE26222-PA 3..211 4..224 313 35.7 Plus