Clone GH14494 Report

Search the DGRC for GH14494

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:144
Well:94
Vector:pOT2
Associated Gene/TranscriptCG17919-RA
Protein status:GH14494.pep: gold
Preliminary Size:957
Sequenced Size:782

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17919 2001-01-01 Release 2 assignment
CG17919 2002-01-09 Blastp of sequenced clone
CG17919 2003-01-01 Sim4 clustering to Release 3
CG17919 2008-04-29 Release 5.5 accounting
CG17919 2008-08-15 Release 5.9 accounting
CG17919 2008-12-18 5.12 accounting

Clone Sequence Records

GH14494.complete Sequence

782 bp (782 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075337

> GH14494.complete
CTTATTCGAAAGCGGAGCTCCTATATATTGGTTTTCTCAAGATCTTATCG
TCTACCGAATAATCTCTCCACAAAGATGCTGCGAGTGCTACTGCCATTGG
TGGGCTGCCTACTGGCCGTTCAAGCTGGCTCCGTGGAGGAGGTTTTCAGA
TCCCACCAGGTGGTACCCGACGTTATTCCCGAGCCGCCGAACCAGTTGTT
AAAGGTCACGTACAGCAACAACCTGGTGGCCAAGGATGGAGTGGAGCTAA
CGCCCACCCAGGTTAAGGATCAGCCAGTCGTGGAGTGGGACGCGCAGCCC
GGGGAGTTCTACACGCTCATTATGACGGATCCCGATGCCCCCAGCCGAGC
GGAGCCCAAGTTCCGCGAGTTCAAGCACTGGATTCTGGCCAACATCGCCG
GCAACGACTTGGCAAGTGGTGAGCCCATCGCCGAGTACATTGGCTCCGGC
CCGCCCCAGGGCACGGGTCTGCATCGCTACGTCTTCCTGCTGTACAAGCA
GTCCGGCAAACTTGAGTTCGACGAGGAGCGCGTGAGCAAGAGATCCCGCA
AGGATCGCCCCAAATTCAGTGCCGCCAAGTTTGCCATCAATCACGAGTTG
GGCAATCCCATTGCTGGAACTTTCTACCAAGCCCAGTACGACGACTATGT
TCCAAAACTGCACAAGCAACTTTCGGAGAATTGATTCCGTTTTAATCTTA
AACAGATACTTTAGGAAAAATCGATTAAAAGATGTTAATCAAAATATAAG
AAATTGCGATTAAAAAAAAAAAAAAAAAAAAA

GH14494.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG17919-RA 799 CG17919-RA 39..799 1..761 3805 100 Plus
snRNP2-RA 907 snRNP2-RA 816..907 762..671 460 100 Minus
snRNP2.a 614 snRNP2.a 525..614 206..117 450 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2170205..2170764 202..761 2800 100 Plus
chr3R 27901430 chr3R 2169723..2169928 1..206 1030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6344528..6345088 202..762 2805 100 Plus
3R 32079331 3R 6344046..6344251 1..206 1030 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6085359..6085919 202..762 2805 100 Plus
3R 31820162 3R 6084877..6085082 1..206 1030 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:04:18 has no hits.

GH14494.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:05:33 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2169723..2169926 1..204 100 -> Plus
chr3R 2170208..2170764 205..761 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:42:46 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 1..609 76..684 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:51:48 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 1..609 76..684 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:12 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 1..609 76..684 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:17:51 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 1..609 76..684 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:27:40 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 1..609 76..684 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:15:25 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 16..776 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:51:48 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 16..776 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:12 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 18..778 1..761 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:52 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 16..776 1..761 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:27:40 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
CG17919-RA 18..778 1..761 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:05:33 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6344046..6344249 1..204 100 -> Plus
3R 6344531..6345087 205..761 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:05:33 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6344046..6344249 1..204 100 -> Plus
3R 6344531..6345087 205..761 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:05:33 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6344046..6344249 1..204 100 -> Plus
3R 6344531..6345087 205..761 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:12 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2169768..2169971 1..204 100 -> Plus
arm_3R 2170253..2170809 205..761 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:58 Download gff for GH14494.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6085362..6085918 205..761 100   Plus
3R 6084877..6085080 1..204 100 -> Plus

GH14494.hyp Sequence

Translation from 1 to 683

> GH14494.hyp
LIRKRSSYILVFSRSYRLPNNLSTKMLRVLLPLVGCLLAVQAGSVEEVFR
SHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDAQP
GEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSG
PPQGTGLHRYVFLLYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHEL
GNPIAGTFYQAQYDDYVPKLHKQLSEN*

GH14494.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG17919-PA 202 CG17919-PA 1..202 26..227 1061 100 Plus
CG10298-PA 187 CG10298-PA 8..184 49..225 564 57.6 Plus
CG6180-PA 257 CG6180-PA 51..255 20..224 551 51.2 Plus
Pebp1-PA 176 CG18594-PA 6..171 54..220 465 51.5 Plus
CG7054-PA 179 CG7054-PA 4..177 54..224 457 50.3 Plus

GH14494.pep Sequence

Translation from 75 to 683

> GH14494.pep
MLRVLLPLVGCLLAVQAGSVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNL
VAKDGVELTPTQVKDQPVVEWDAQPGEFYTLIMTDPDAPSRAEPKFREFK
HWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFLLYKQSGKLEFDE
ERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQLS
EN*

GH14494.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16396-PA 202 GF16396-PA 1..202 1..202 888 82.2 Plus
Dana\GF16395-PA 186 GF16395-PA 6..184 22..200 580 58.7 Plus
Dana\GF14208-PA 260 GF14208-PA 78..258 19..199 532 53 Plus
Dana\GF23378-PA 175 GF23378-PA 4..173 29..199 494 54.7 Plus
Dana\GF23379-PA 176 GF23379-PA 6..171 29..195 454 50.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13347-PA 202 GG13347-PA 1..202 1..202 1028 96 Plus
Dere\GG13336-PA 187 GG13336-PA 7..184 23..200 568 57.9 Plus
Dere\GG23796-PA 178 GG23796-PA 1..177 24..200 536 56.5 Plus
Dere\GG11138-PA 179 GG11138-PA 4..177 29..199 468 52.6 Plus
Dere\GG11139-PA 176 GG11139-PA 6..171 29..195 463 51.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14040-PA 202 GH14040-PA 7..202 8..202 764 70.4 Plus
Dgri\GH14039-PA 186 GH14039-PA 4..184 20..200 551 52.5 Plus
Dgri\GH13213-PA 178 GH13213-PA 4..177 27..200 535 56.3 Plus
Dgri\GH22229-PA 177 GH22229-PA 4..176 29..200 501 56.3 Plus
Dgri\GH22236-PA 176 GH22236-PA 6..175 29..199 450 46.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17919-PA 202 CG17919-PA 1..202 1..202 1061 100 Plus
CG10298-PA 187 CG10298-PA 8..184 24..200 564 57.6 Plus
CG6180-PA 257 CG6180-PA 76..255 20..199 544 56.7 Plus
Pebp1-PA 176 CG18594-PA 6..171 29..195 465 51.5 Plus
CG7054-PA 179 CG7054-PA 4..177 29..199 457 50.3 Plus
a5-PA 210 CG5430-PA 25..205 19..199 452 39.8 Plus
CG17917-PA 211 CG17917-PA 22..204 20..202 417 44.3 Plus
CG30060-PA 202 CG30060-PA 2..179 8..188 256 30.4 Plus
mRpL38-PA 416 CG15871-PA 125..317 12..196 177 27.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24414-PA 202 GI24414-PA 1..200 1..200 613 56 Plus
Dmoj\GI24413-PA 183 GI24413-PA 1..181 20..200 585 59.1 Plus
Dmoj\GI21977-PA 179 GI21977-PA 4..178 29..200 524 58 Plus
Dmoj\GI14504-PA 178 GI14504-PA 6..177 29..200 522 55.2 Plus
Dmoj\GI21978-PA 177 GI21978-PA 6..177 29..201 465 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24079-PA 203 GL24079-PA 3..202 8..201 760 72 Plus
Dper\GL24078-PA 189 GL24078-PA 1..186 15..200 613 59.1 Plus
Dper\GL19726-PA 256 GL19726-PA 67..254 12..199 560 54.3 Plus
Dper\GL24219-PA 179 GL24219-PA 4..178 29..200 465 52.3 Plus
Dper\GL24075-PA 220 GL24075-PA 7..207 4..201 410 43.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14724-PA 203 GA14724-PA 1..202 1..201 777 70.8 Plus
Dpse\GA10227-PA 189 GA10227-PA 1..186 15..200 611 59.1 Plus
Dpse\GA19416-PA 256 GA19416-PA 71..254 16..199 558 54.9 Plus
Dpse\GA20063-PA 179 GA20063-PA 4..178 29..200 464 52.3 Plus
Dpse\GA15006-PA 176 GA15006-PA 6..175 29..199 432 46.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10887-PA 202 GM10887-PA 1..202 1..202 1035 96.5 Plus
Dsec\GM10886-PA 187 GM10886-PA 7..184 23..200 549 57.3 Plus
Dsec\GM10048-PA 178 GM10048-PA 1..177 24..200 540 57.1 Plus
Dsec\GM26437-PA 176 GM26437-PA 6..171 29..195 465 51.5 Plus
Dsec\GM26436-PA 179 GM26436-PA 4..177 29..199 451 50.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19866-PA 202 GD19866-PA 1..202 1..202 1037 96.5 Plus
Dsim\GD19865-PA 187 GD19865-PA 7..184 23..200 564 58.4 Plus
Dsim\GD23851-PA 178 GD23851-PA 1..177 24..200 540 57.1 Plus
Dsim\GD20954-PA 176 GD20954-PA 6..171 29..195 463 51.5 Plus
Dsim\GD20953-PA 179 GD20953-PA 4..177 29..199 449 49.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14272-PA 200 GJ14272-PA 1..198 1..199 659 60.3 Plus
Dvir\GJ14271-PA 186 GJ14271-PA 6..184 22..200 575 58.1 Plus
Dvir\GJ16279-PA 226 GJ16279-PA 26..224 1..199 554 50.3 Plus
Dvir\GJ14337-PA 179 GJ14337-PA 4..178 29..200 518 54.5 Plus
Dvir\GJ14270-PA 218 GJ14270-PA 29..209 19..199 456 45.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13056-PA 202 GK13056-PA 1..202 1..202 789 72.9 Plus
Dwil\GK13055-PA 191 GK13055-PA 1..188 13..200 648 59.6 Plus
Dwil\GK14662-PA 256 GK14662-PA 71..254 16..199 555 55.4 Plus
Dwil\GK11701-PA 180 GK11701-PA 6..178 29..202 472 49.4 Plus
Dwil\GK11698-PA 176 GK11698-PA 6..175 29..199 465 49.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:04:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10211-PA 202 GE10211-PA 1..202 1..202 997 92.6 Plus
Dyak\GE10210-PA 187 GE10210-PA 7..184 23..200 575 58.4 Plus
Dyak\GE18600-PA 178 GE18600-PA 1..177 24..200 540 56.5 Plus
Dyak\GE10305-PA 176 GE10305-PA 6..171 29..195 462 51.5 Plus
Dyak\GE10304-PA 179 GE10304-PA 4..177 29..199 455 51.4 Plus