Clone GH14561 Report

Search the DGRC for GH14561

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:145
Well:61
Vector:pOT2
Associated Gene/TranscriptVps24-RA
Protein status:GH14561.pep: gold
Preliminary Size:752
Sequenced Size:1094

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9779 2001-01-01 Release 2 assignment
CG9779 2001-09-19 Blastp of sequenced clone
CG9779 2003-01-01 Sim4 clustering to Release 3
CG9779 2008-04-29 Release 5.5 accounting
CG9779 2008-08-15 Release 5.9 accounting
CG9779 2008-12-18 5.12 accounting

Clone Sequence Records

GH14561.complete Sequence

1094 bp (1094 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058381

> GH14561.complete
AAATGACTCACTTGTTTGTTTAAACAAAAAAAGAATTTTAATAACAATTC
CAGACAATTATCATAACAGTTAGTGCCATGGGCTTATTCGGCAGAACTCC
CAGTAAAGATCCCAAAGAGCAGGTGCAGGAGTGGACGCATAAGATACGGA
AAGAGGGCAACCAGCTGGATCGCCAGATCCGAAGTATCCAGCGCGAGGAA
GAGAAAGTAAAACGCTCGCTGAAACAGGCAGCACAGAAAAATGACCGCGA
CACCTGCGTCATTCTTGCCAAGGAGATTGTGAATGCGCGAAAGGCCATCA
ACCGCATATATACGTCGAAGGCGCACCTCAACTCCATTCAGATGCAGATG
AAAAATCAGCTATCCACCTTGCGTGTAGCTGGATCTCTGCAAAAGTCTAC
AGAGGTCTTGCAAGCTATGCAGAGCCTGGTGCGCTATCCAGAGCTTGCAG
GCATCATGCGCGACATGTCAAAGGAAATGATGAAGGCCGGCATTATTGAG
GAGATGCTAGACGAGACCATGGACTCGCTGGAGGAGTCCGAGGAGCTGGA
GGAGGAGGCAAGCAAGGAGGTGGACAAGGTTTTGTGGGAGATCACAGATG
GCAAGCTCGGGGAAGCTCCCCTGCCTCCAGAGGCTACACCGGCGGACAAG
GCGTCTGCGTCTGCTGCGCGCGTCGAGGCTGAGCAGGACGATGAGGAGGG
TGAGGAACTGCAAGAGATGCAAAGCCGCCTGGCCTCGCTGCGATCTTAAA
ACAACTGCTATGGGTATTTTATTTAGATTTGAAATTAAAGGCAAGTGATT
TTGACTGGCAGACCTTATCAAAATCATAAACGGCAACCCCCACGCCGTCA
TTTGATTGTAGAAACCAAAATAATCTCCAGAAACTTGAATTGAGTTTTTA
TATTATAAGTGTACAGTACACCAGATCAAGAAGTGTTGAACTCTGCGCGT
TTTACCGTTGAATCTACACGAGATAACTTAATTTATTGTAAAATCTACCT
TTCATTAAAAATCGATATTTACTGTGGCATGTCCCATTTTACAATGGTAA
TCTGCACGATTTACGATCAATCCCTAAAAAAAAAAAAAAAAAAA

GH14561.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9779-RA 1198 CG9779-RA 74..1150 1..1077 5385 100 Plus
CG9779.a 1113 CG9779.a 40..1110 1..1077 5270 99.4 Plus
MP1-RC 1497 MP1-RC 1305..1497 1077..885 965 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 135367..136078 1075..364 3560 100 Minus
chr3R 27901430 chr3R 136134..136376 363..121 1215 100 Minus
chr3R 27901430 chr3R 136505..136628 124..1 620 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4309645..4310358 1077..364 3570 100 Minus
3R 32079331 3R 4310414..4310656 363..121 1215 100 Minus
3R 32079331 3R 4310785..4310908 124..1 620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4050476..4051189 1077..364 3570 100 Minus
3R 31820162 3R 4051245..4051487 363..121 1215 100 Minus
3R 31820162 3R 4051616..4051739 124..1 620 100 Minus
Blast to na_te.dros performed 2019-03-15 20:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 650..698 20..68 110 69.4 Plus

GH14561.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:25:24 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 136507..136628 1..122 100   Minus
chr3R 135367..136078 364..1075 100 <- Minus
chr3R 136134..136374 123..363 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:42:52 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
CG9779-RA 1..672 78..749 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:07:23 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
vps24-RA 1..672 78..749 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:07:00 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
vps24-RA 1..672 78..749 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:38:10 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
CG9779-RA 1..672 78..749 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:15 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
Vps24-RA 1..672 78..749 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:57:27 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
CG9779-RA 38..1112 1..1075 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:07:23 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
vps24-RA 38..1112 1..1075 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:07:00 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
vps24-RA 40..1114 1..1075 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:38:10 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
CG9779-RA 38..1112 1..1075 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:15 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
Vps24-RA 40..1114 1..1075 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:24 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4309647..4310358 364..1075 100 <- Minus
3R 4310414..4310654 123..363 100 <- Minus
3R 4310787..4310908 1..122 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:24 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4309647..4310358 364..1075 100 <- Minus
3R 4310414..4310654 123..363 100 <- Minus
3R 4310787..4310908 1..122 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:25:24 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4309647..4310358 364..1075 100 <- Minus
3R 4310414..4310654 123..363 100 <- Minus
3R 4310787..4310908 1..122 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:07:00 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 135369..136080 364..1075 100 <- Minus
arm_3R 136136..136376 123..363 100 <- Minus
arm_3R 136509..136630 1..122 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:15:27 Download gff for GH14561.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4050478..4051189 364..1075 100 <- Minus
3R 4051245..4051485 123..363 100 <- Minus
3R 4051618..4051739 1..122 100   Minus

GH14561.hyp Sequence

Translation from 77 to 748

> GH14561.hyp
MGLFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQ
AAQKNDRDTCVILAKEIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRV
AGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDS
LEESEELEEEASKEVDKVLWEITDGKLGEAPLPPEATPADKASASAARVE
AEQDDEEGEELQEMQSRLASLRS*

GH14561.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Vps24-PA 223 CG9779-PA 1..223 1..223 1103 100 Plus
CHMP2B-PA 212 CG4618-PA 5..205 3..206 227 28 Plus
Vps2-PA 256 CG14542-PA 4..183 3..181 195 25.8 Plus

GH14561.pep Sequence

Translation from 77 to 748

> GH14561.pep
MGLFGRTPSKDPKEQVQEWTHKIRKEGNQLDRQIRSIQREEEKVKRSLKQ
AAQKNDRDTCVILAKEIVNARKAINRIYTSKAHLNSIQMQMKNQLSTLRV
AGSLQKSTEVLQAMQSLVRYPELAGIMRDMSKEMMKAGIIEEMLDETMDS
LEESEELEEEASKEVDKVLWEITDGKLGEAPLPPEATPADKASASAARVE
AEQDDEEGEELQEMQSRLASLRS*

GH14561.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16818-PA 226 GF16818-PA 1..226 1..223 930 91.2 Plus
Dana\GF23969-PA 212 GF23969-PA 5..184 3..181 163 27.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11685-PA 223 GG11685-PA 1..223 1..223 1124 96.9 Plus
Dere\GG15261-PA 212 GG15261-PA 5..211 3..223 161 28.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17415-PA 225 GH17415-PA 1..225 1..223 977 92 Plus
Dgri\GH16177-PA 212 GH16177-PA 5..211 3..223 179 28.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
Vps24-PB 223 CG9779-PB 1..223 1..223 1103 100 Plus
Vps24-PA 223 CG9779-PA 1..223 1..223 1103 100 Plus
CHMP2B-PA 212 CG4618-PA 5..205 3..206 227 28 Plus
Vps2-PA 256 CG14542-PA 4..183 3..181 195 25.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22744-PA 223 GI22744-PA 1..223 1..223 983 92.8 Plus
Dmoj\GI13330-PA 212 GI13330-PA 5..184 3..181 182 29.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12331-PA 223 GL12331-PA 1..223 1..223 997 94.2 Plus
Dper\GL22617-PA 212 GL22617-PA 5..189 3..186 179 29.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22030-PA 223 GA22030-PA 1..223 1..223 988 93.3 Plus
Dpse\GA18306-PA 212 GA18306-PA 5..189 3..186 179 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10712-PA 223 GM10712-PA 1..223 1..223 1135 97.8 Plus
Dsec\GM14695-PA 212 GM14695-PA 5..211 3..223 163 28.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19689-PA 223 GD19689-PA 1..223 1..223 1135 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22745-PA 223 GJ22745-PA 1..223 1..223 996 93.7 Plus
Dvir\GJ13157-PA 212 GJ13157-PA 5..211 3..223 221 28.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12139-PA 229 GK12139-PA 1..229 1..223 949 86.5 Plus
Dwil\GK20320-PA 213 GK20320-PA 5..196 3..195 215 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25363-PA 223 GE25363-PA 1..223 1..223 1046 94.6 Plus
Dyak\GE21483-PA 212 GE21483-PA 5..184 3..181 167 30.6 Plus