Clone GH14622 Report

Search the DGRC for GH14622

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:146
Well:22
Vector:pOT2
Associated Gene/TranscriptCG1394-RA
Protein status:GH14622.pep: gold
Preliminary Size:946
Sequenced Size:834

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1394 2001-01-01 Release 2 assignment
CG1394 2001-10-10 Blastp of sequenced clone
CG1394 2003-01-01 Sim4 clustering to Release 3
CG1394 2008-04-29 Release 5.5 accounting
CG1394 2008-08-15 Release 5.9 accounting
CG1394 2008-12-18 5.12 accounting

Clone Sequence Records

GH14622.complete Sequence

834 bp (834 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060705

> GH14622.complete
TAAACACCGTTCAGCGGAGCAAAATTTTGTACAACTTTTATTTGGTCAAA
AAAAAAAAAATCGAAAGAAAAACTGTTTCTTTTTCACCACTTTCCCAAAT
TATTTGTATTTAGGATTTACTCAACCGCAACTCACAATATGTCGAATTCG
TTTTCGTACTGGAATGGCCAGCCGTTGAATGCTCCCGTTTATCCGCAGAT
GGGTGACTTCATGCAGCACTCTGCCGCTGGAGCAGCCGCTCCACCACCAC
TATCAGCAACAGCAGCAGCACCAGGATTAGGATCAGCCGGCGGACTAGGA
GGTTGGCCTAGCCAGGGCGCAGCTCAGGCACACTCCATGCTACCATACGC
CGGAGGAGCCGGTGGCATGCCGGCTGCCATGCCGGGTGCCATGCCGGGCG
TCATGCCGGGTGCCATGTCGGGTGCCATGCCGGGTGCCATGCCGGGTGCC
ATGTCGTGTGGCATGCCCATTACAGGAGCCCAGCATATAGTGCCGCCACC
CGTGGACCGTTCAATATATGGAGACATACCCGGACGAAATGAACCGTGCA
TCGACAATGGCGAAGCCTTCTGCGCCTACAACGGCATGGACATGAGCATG
AACTACGGCGGAGGCAGTGCATCCAAGGGTGGCTTCTGGTAGGATCGATG
CCACGAACAATGACAGCACGAGCATCTTCACCGAACGACTAAAGTGAATC
GCATATGGGCCATATACATACACAATTAGTTTTCGAACCAAACGTCCGTT
TTGTGCAGCTCAAACGACTCGTACTTGGCGAAAATGTATAAAATAAATGT
CATAAATCCATAAAAAAAAAAAAAAAAAAAAAAA

GH14622.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG1394-RA 827 CG1394-RA 2..814 1..813 4065 100 Plus
CG15200-RA 557 CG15200-RA 378..434 541..597 210 91.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11061090..11061899 811..1 4005 99.9 Minus
chrX 22417052 chrX 11074535..11074591 541..597 210 91.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11169835..11170647 813..1 4065 100 Minus
X 23542271 X 11183308..11183364 541..597 210 91.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11177933..11178745 813..1 4065 100 Minus
X 23527363 X 11191406..11191462 541..597 210 91.2 Plus
Blast to na_te.dros performed 2019-03-16 10:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6838 227..289 153 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2411 224..289 150 69.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2323..2379 231..287 141 71.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2349..2417 221..289 138 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2363 232..289 137 70.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6799..6885 213..300 131 62.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6670..6763 199..289 129 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6805 221..289 129 65.2 Plus
roo 9092 roo DM_ROO 9092bp 1064..1132 221..289 129 65.2 Plus
roo 9092 roo DM_ROO 9092bp 1090..1163 213..287 129 65.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2786..2852 223..289 128 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6848..6914 221..287 128 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6784 227..289 126 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6817 227..289 126 66.7 Plus
roo 9092 roo DM_ROO 9092bp 1082..1144 227..289 126 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2373 224..287 122 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6833..6899 221..287 119 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6850 214..289 116 63.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6794 227..287 116 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2363..2422 213..273 113 67.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1528..1597 231..301 109 63.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2744..2820 210..287 108 61.5 Plus

GH14622.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:26:54 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11061090..11061433 468..811 100 == Minus
chrX 11061541..11061899 1..360 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:07 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 1..504 139..642 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:51:59 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 1..504 139..642 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:17 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 1..504 139..642 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:21:11 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 1..504 139..642 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:07:25 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 1..504 139..642 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:36:57 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 2..812 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:51:59 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 2..812 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:17 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 2..812 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:21:11 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 2..812 1..811 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:07:25 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
CG1394-RA 32..842 1..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:54 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
X 11169837..11170647 1..811 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:54 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
X 11169837..11170647 1..811 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:54 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
X 11169837..11170647 1..811 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:17 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11063870..11064680 1..811 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:51 Download gff for GH14622.complete
Subject Subject Range Query Range Percent Splice Strand
X 11177935..11178745 1..811 100   Minus

GH14622.hyp Sequence

Translation from 138 to 641

> GH14622.hyp
MSNSFSYWNGQPLNAPVYPQMGDFMQHSAAGAAAPPPLSATAAAPGLGSA
GGLGGWPSQGAAQAHSMLPYAGGAGGMPAAMPGAMPGVMPGAMSGAMPGA
MPGAMSCGMPITGAQHIVPPPVDRSIYGDIPGRNEPCIDNGEAFCAYNGM
DMSMNYGGGSASKGGFW*

GH14622.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG1394-PB 167 CG1394-PB 1..167 1..167 920 100 Plus
CG1394-PA 167 CG1394-PA 1..167 1..167 920 100 Plus

GH14622.pep Sequence

Translation from 138 to 641

> GH14622.pep
MSNSFSYWNGQPLNAPVYPQMGDFMQHSAAGAAAPPPLSATAAAPGLGSA
GGLGGWPSQGAAQAHSMLPYAGGAGGMPAAMPGAMPGVMPGAMSGAMPGA
MPGAMSCGMPITGAQHIVPPPVDRSIYGDIPGRNEPCIDNGEAFCAYNGM
DMSMNYGGGSASKGGFW*

GH14622.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22588-PA 139 GF22588-PA 1..118 1..155 170 36.1 Plus
Dana\GF22360-PA 182 GF22360-PA 119..165 97..156 135 48.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18871-PA 139 GG18871-PA 1..139 1..167 310 50.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG1394-PB 167 CG1394-PB 1..167 1..167 920 100 Plus
CG1394-PA 167 CG1394-PA 1..167 1..167 920 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20302-PA 173 GL20302-PA 1..158 1..156 180 35 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13564-PA 173 GA13564-PA 1..158 1..156 182 36 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11255-PA 143 GM11255-PA 1..143 1..167 346 66.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15998-PA 155 GD15998-PA 1..155 1..167 403 77.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16108-PA 180 GK16108-PA 4..147 3..155 146 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17312-PA 156 GE17312-PA 1..156 1..167 304 55.2 Plus