Clone GH14654 Report

Search the DGRC for GH14654

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:146
Well:54
Vector:pOT2
Associated Gene/TranscriptGstE1-RA
Protein status:GH14654.pep: gold
Preliminary Size:821
Sequenced Size:838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5164 2001-01-01 Release 2 assignment
CG5164 2001-09-19 Blastp of sequenced clone
CG5164 2003-01-01 Sim4 clustering to Release 3
GstE1 2008-04-29 Release 5.5 accounting
GstE1 2008-08-15 Release 5.9 accounting
GstE1 2008-12-18 5.12 accounting

Clone Sequence Records

GH14654.complete Sequence

838 bp (838 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058383

> GH14654.complete
AAAACACTGACGGGTAAACAACACGTATCATGTCGAGCTCTGGAATTGTA
CTCTATGGGACAGATCTCAGTCCCTGTGTGAGGACCGTCAAACTTACCCT
AAAGGTCCTGAATCTGGACTACGAGTACAAGGAGGTGAATCTTCAGGCGG
GCGAGCACCTGAGCGAGGAATATGTGAAGAAGAATCCCCAACACACGGTA
CCGATGCTCGATGATAATGGCACTTTCATCTGGGACTCCCATGCCATTGC
CGCCTACTTGGTGGACAAGTATGCCAAGTCGGATGAGCTGTATCCCAAGG
ATCTGGCCAAGCGTGCGATCGTCAATCAGCGTCTCTTCTTCGATGCCAGT
GTAATCTATGCCAGTATAGCCAATGTCAGCCGCCCGTTTTGGATAAACGG
TGTTACCGAAGTGCCCCAGGAAAAACTGGACGCCGTACACCAGGGTCTGA
AGCTGCTGGAGACGTTCCTGGGCAACAGCCCCTACCTGGCCGGCGATTCG
CTAACCCTAGCCGATCTGTCCACCGGACCCACTGTAAGCGCCGTGCCCGC
TGCCGTGGACATAGATCCTGCTACATATCCCAAGGTCACCGCCTGGTTGG
ATCGCCTCAATAAGCTGCCCTACTACAAGGAGATCAACGAAGCTCCGGCC
CAGAGCTACGTCGCCTTCCTGCGCAGCAAGTGGACCAAGCTGGGCGACAA
GTGAAACTAAACTTATATTTAAATATGACATTTCACAAGTTTGAATTCCA
TCAATTAACAACATACACATCCATTTCTAAAACGTAAACTTCTTCAATAA
AATATAACATATATATAAAATAAAAAAAAAAAAAAAAA

GH14654.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
GstE1-RA 835 GstE1-RA 14..835 1..822 4110 100 Plus
GstE2-RA 892 GstE2-RA 184..310 180..306 290 81.8 Plus
GstE10-RA 723 GstE10-RA 145..268 180..303 245 79.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14285449..14286269 1..821 4030 99.4 Plus
chr2R 21145070 chr2R 14286652..14286886 115..349 320 75.7 Plus
chr2R 21145070 chr2R 14284224..14284360 316..180 250 78.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18398403..18399224 1..822 4110 100 Plus
2R 25286936 2R 18399606..18399840 115..349 305 75.3 Plus
2R 25286936 2R 18397198..18397321 303..180 245 79.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18399602..18400423 1..822 4110 100 Plus
2R 25260384 2R 18400870..18400996 180..306 290 81.8 Plus
2R 25260384 2R 18398397..18398520 303..180 245 79.8 Minus
Blast to na_te.dros performed on 2019-03-15 21:43:45 has no hits.

GH14654.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:44:52 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14285449..14286269 1..821 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:09 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 1..675 30..704 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:07:09 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 1..675 30..704 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:56:27 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 1..675 30..704 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:37:58 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 1..675 30..704 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:19 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 1..675 30..704 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:57:11 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 14..834 1..821 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:07:09 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 11..831 1..821 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:56:27 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 11..831 1..821 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:37:58 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 14..834 1..821 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:19 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
GstE1-RA 11..831 1..821 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:52 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18398403..18399223 1..821 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:52 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18398403..18399223 1..821 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:52 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18398403..18399223 1..821 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:56:27 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14285908..14286728 1..821 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:15:10 Download gff for GH14654.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18399602..18400422 1..821 100   Plus

GH14654.hyp Sequence

Translation from 29 to 703

> GH14654.hyp
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVK
KNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQ
RLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNS
PYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYK
EINEAPAQSYVAFLRSKWTKLGDK*

GH14654.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
GstE1-PA 224 CG5164-PA 1..224 1..224 1162 100 Plus
GstE2-PA 221 CG17523-PA 2..214 3..215 652 56.3 Plus
GstE7-PA 223 CG17531-PA 4..214 6..215 562 49.8 Plus
GstE9-PA 221 CG17534-PA 4..220 6..221 559 49.3 Plus
GstE5-PA 222 CG17527-PA 4..215 6..216 558 49.5 Plus

GH14654.pep Sequence

Translation from 29 to 703

> GH14654.pep
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVK
KNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQ
RLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNS
PYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYK
EINEAPAQSYVAFLRSKWTKLGDK*

GH14654.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:57:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12160-PA 223 GF12160-PA 1..223 1..223 974 78.5 Plus
Dana\GF12161-PA 223 GF12161-PA 1..223 1..223 941 77.1 Plus
Dana\GF12168-PA 219 GF12168-PA 2..219 4..221 710 59.2 Plus
Dana\GF12162-PA 216 GF12162-PA 2..213 4..219 661 56.9 Plus
Dana\GF12175-PA 221 GF12175-PA 4..220 6..221 585 52.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21880-PA 224 GG21880-PA 1..224 1..224 1124 93.3 Plus
Dere\GG21881-PA 223 GG21881-PA 1..222 1..222 979 80.2 Plus
Dere\GG21885-PA 219 GG21885-PA 2..219 4..221 682 56 Plus
Dere\GG21882-PA 221 GG21882-PA 2..214 3..215 662 56.8 Plus
Dere\GG21890-PA 222 GG21890-PA 2..214 4..215 567 49.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15974-PA 219 GH15974-PA 4..217 6..219 689 57.9 Plus
Dgri\GH13569-PA 220 GH13569-PA 2..218 4..221 654 59.6 Plus
Dgri\GH13568-PA 220 GH13568-PA 2..218 4..221 640 56.9 Plus
Dgri\GH21671-PA 221 GH21671-PA 4..220 6..221 551 49.3 Plus
Dgri\GH21669-PA 221 GH21669-PA 4..218 6..219 548 48.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
GstE1-PA 224 CG5164-PA 1..224 1..224 1162 100 Plus
GstE2-PA 221 CG17523-PA 2..214 3..215 652 56.3 Plus
GstE7-PA 223 CG17531-PA 4..214 6..215 562 49.8 Plus
GstE9-PA 221 CG17534-PA 4..220 6..221 559 49.3 Plus
GstE5-PA 222 CG17527-PA 4..215 6..216 558 49.5 Plus
GstE6-PA 222 CG17530-PA 4..214 6..215 536 49.8 Plus
GstE8-PB 222 CG17533-PB 2..214 4..215 532 47.4 Plus
GstE8-PA 222 CG17533-PA 2..214 4..215 532 47.4 Plus
GstE4-PA 222 CG17525-PA 4..216 6..217 529 49.3 Plus
GstE3-PA 220 CG17524-PA 4..215 6..217 526 48.1 Plus
GstE10-PB 240 CG17522-PB 2..224 4..224 525 47.5 Plus
GstE10-PA 240 CG17522-PA 2..224 4..224 525 47.5 Plus
GstE12-PC 223 CG16936-PC 6..216 8..217 424 42.7 Plus
GstE12-PB 223 CG16936-PB 6..216 8..217 424 42.7 Plus
GstE12-PD 223 CG16936-PD 6..216 8..217 424 42.7 Plus
GstE12-PA 223 CG16936-PA 6..216 8..217 424 42.7 Plus
GstE11-PB 225 CG5224-PB 1..216 1..215 415 40.1 Plus
GstE11-PA 225 CG5224-PA 1..216 1..215 415 40.1 Plus
GstD1-PB 209 CG10045-PB 11..190 14..196 371 43.2 Plus
GstD1-PA 209 CG10045-PA 11..190 14..196 371 43.2 Plus
GstD2-PA 215 CG4181-PA 13..189 18..196 356 43 Plus
GstD6-PA 215 CG4423-PA 3..207 8..214 350 39.1 Plus
GstD3-PA 199 CG4381-PA 4..184 25..207 343 39.9 Plus
GstD4-PA 215 CG11512-PA 13..189 18..196 343 40.2 Plus
GstD9-PB 218 CG10091-PB 11..198 14..201 343 40.5 Plus
GstD9-PA 218 CG10091-PA 11..198 14..201 343 40.5 Plus
GstD7-PA 224 CG4371-PA 6..212 8..215 343 38.8 Plus
GstD8-PA 212 CG4421-PA 10..189 14..196 339 41 Plus
GstD5-PA 216 CG12242-PA 13..189 18..196 330 41.3 Plus
GstE13-PB 226 CG11784-PB 6..203 8..203 328 35.9 Plus
GstE13-PA 226 CG11784-PA 6..203 8..203 328 35.9 Plus
GstD10-PB 210 CG18548-PB 5..204 9..210 325 37.4 Plus
GstD10-PA 210 CG18548-PA 5..204 9..210 325 37.4 Plus
GstD11-PA 222 CG17639-PA 5..216 7..217 324 36 Plus
GstD11-PB 243 CG17639-PB 26..237 7..217 324 36 Plus
gfzf-PD 234 CG33546-PD 3..209 8..213 280 34.9 Plus
gfzf-PE 1045 CG33546-PE 814..1020 8..213 280 34.9 Plus
gfzf-PB 1045 CG33546-PB 814..1020 8..213 280 34.9 Plus
GstE14-PA 232 CG4688-PA 1..199 1..200 256 31.6 Plus
GstT2-PA 228 CG30005-PA 2..211 3..201 202 30.5 Plus
GstT1-PA 228 CG30000-PA 2..211 3..201 184 28.1 Plus
GstT3-PC 228 CG1702-PC 2..214 3..204 173 28.2 Plus
GstT3-PA 228 CG1702-PA 2..214 3..204 173 28.2 Plus
GstT3-PB 268 CG1702-PB 42..254 3..204 173 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16624-PA 219 GI16624-PA 2..217 4..219 691 58.3 Plus
Dmoj\GI16623-PA 219 GI16623-PA 2..217 4..219 678 56.5 Plus
Dmoj\GI24095-PA 219 GI24095-PA 2..217 5..221 664 56.7 Plus
Dmoj\GI20124-PA 221 GI20124-PA 4..220 6..221 539 47.9 Plus
Dmoj\GI20122-PA 221 GI20122-PA 5..221 7..222 536 50.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17768-PA 222 GL17768-PA 2..221 3..222 911 72.7 Plus
Dper\GL17769-PA 219 GL17769-PA 2..217 4..219 651 56.5 Plus
Dper\GL17771-PA 221 GL17771-PA 4..215 6..217 545 49.8 Plus
Dper\GL17773-PA 222 GL17773-PA 4..214 6..215 529 48.3 Plus
Dper\GL17774-PA 221 GL17774-PA 4..220 6..221 519 48.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18702-PA 222 GA18702-PA 2..221 3..222 910 72.7 Plus
Dpse\GA14540-PA 219 GA14540-PA 2..217 4..219 654 56.5 Plus
Dpse\GA14542-PA 221 GA14542-PA 4..215 6..217 548 50.2 Plus
Dpse\GA14545-PA 222 GA14545-PA 4..215 6..216 535 48.6 Plus
Dpse\GA14539-PA 241 GA14539-PA 4..225 6..224 515 47.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21874-PA 334 GM21874-PA 153..333 42..222 746 75.1 Plus
Dsec\GM21874-PA 334 GM21874-PA 5..140 89..224 687 94.9 Plus
Dsec\GM21875-PA 221 GM21875-PA 2..214 3..215 677 57.3 Plus
Dsec\GM21878-PA 219 GM21878-PA 2..219 4..221 669 55 Plus
Dsec\GM21881-PA 223 GM21881-PA 4..214 6..215 577 50.2 Plus
Dsec\GM21880-PA 222 GM21880-PA 4..215 6..216 560 49.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11370-PA 224 GD11370-PA 1..224 1..224 1134 94.6 Plus
Dsim\GD11372-PA 219 GD11372-PA 2..219 4..221 678 56 Plus
Dsim\GD11376-PA 223 GD11376-PA 4..214 6..215 579 50.2 Plus
Dsim\GD11377-PA 222 GD11377-PA 2..214 4..215 567 49.3 Plus
Dsim\GD11378-PA 221 GD11378-PA 4..220 6..221 556 49.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21357-PA 220 GJ21357-PA 2..218 4..221 703 60.1 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 2..217 4..219 694 58.3 Plus
Dvir\GJ22450-PA 238 GJ22450-PA 3..222 6..224 542 45.5 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 4..220 6..221 536 46.5 Plus
Dvir\GJ19893-PA 221 GJ19893-PA 4..215 6..217 527 49.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:57:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22981-PA 223 GK22981-PA 3..223 4..223 767 64 Plus
Dwil\GK22987-PA 219 GK22987-PA 2..217 4..219 712 59.3 Plus
Dwil\GK22985-PA 219 GK22985-PA 2..217 4..219 704 59.3 Plus
Dwil\GK22982-PA 218 GK22982-PA 3..216 6..219 663 56.1 Plus
Dwil\GK22983-PA 222 GK22983-PA 6..216 8..217 575 51.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11960-PA 219 GE11960-PA 2..219 4..221 695 56.9 Plus
Dyak\GstE2-PA 221 GE11957-PA 2..214 3..215 668 56.8 Plus
Dyak\GE11962-PA 222 GE11962-PA 4..215 6..216 574 49.5 Plus
Dyak\GE11964-PA 222 GE11964-PA 4..215 6..217 567 50.7 Plus
Dyak\GE11965-PA 222 GE11965-PA 2..214 4..215 562 48.8 Plus