Clone GH14656 Report

Search the DGRC for GH14656

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:146
Well:56
Vector:pOT2
Associated Gene/TranscriptCG12699-RB
Protein status:GH14656.pep: gold
Preliminary Size:889
Sequenced Size:794

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12699 2001-01-01 Release 2 assignment
CG12699 2008-04-29 Release 5.5 accounting
CG12699 2008-08-15 Release 5.9 accounting
CG12699 2008-12-18 5.12 accounting

Clone Sequence Records

GH14656.complete Sequence

794 bp (794 high quality bases) assembled on 2001-11-29

GenBank Submission: AY089506.1

> GH14656.complete
CAACCGTTAACAACTATTACTATAAGATAAATTCATTTCGACCTAGCCGT
TTTTTCACCTCCAACAGTCCAAAATGTCAGAAGAAGAAGCCCCAGGATCT
CCGGGTGAGGCTGTTGAAGAAGAAGATACCACTACATCCGATGCTGATAC
AACCACAGCTGGTGCCCGCATGATGATGATCCACCCATGGCTGACGGCCG
CCGCAGTGGCCATGTATGCCACCAAGGTCATGTGGGTCAAGTTCCGTGAG
ATCGGCCTGGCTAAACAGGAAAAACGGCTCAAAAATCAACTGGCGAAGCA
GTCTAAGCCCTTGCAGACTATTGATGAAGATGTTTCCGAATCTGATGCAG
AATATGATGCAGAATCTGATGCAGAATCTGATGCAGAATCAGATGCAGAG
GACGAAGACGTCGTCGGGCCCCAAGTCGAAGATGCAGCAGAGGGACCGGG
ATTCGAGCCAAACCGTGTGGATATATGCCATCGCCCGATCGAAGTCTCTA
CTGACTGCTGATGTTCGAATCGGGGATGAAGGACCGCGGAAGGATGAACA
TGCACACACACACTGGACAACTACACTAATTGTTGTAATGCTTGCGTTTT
CCGTAGGGGAGGATCCACGGACAATGTTTGACATGTACCACCACATTGGG
GGACACAAATTGTTAGTTTTAAAACATTAACCAAATTTCTTGTACCACAT
TGCGATATTTGAATTAGTTTTTATGAGTTTATATTAAATGCTGCGATGAA
AGTATGGTACCCTATTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH14656.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12699-RB 976 CG12699-RB 68..839 1..772 3845 99.8 Plus
CG18469-RA 509 CG18469-RA 108..212 164..268 225 80.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13133588..13134277 766..65 3295 98.3 Minus
chr2R 21145070 chr2R 13134363..13134429 67..1 335 100 Minus
chr2R 21145070 chr2R 13133121..13133225 268..164 225 81 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17246524..17247231 772..65 3525 99.9 Minus
2R 25286936 2R 17247317..17247383 67..1 335 100 Minus
2R 25286936 2R 17246066..17246170 268..164 225 81 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17247723..17248430 772..65 3525 99.8 Minus
2R 25260384 2R 17248516..17248582 67..1 335 100 Minus
2R 25260384 2R 17247265..17247369 268..164 225 80.9 Minus
Blast to na_te.dros performed on 2019-03-16 04:10:56 has no hits.

GH14656.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:12:04 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13133588..13134274 68..766 91 <- Minus
chr2R 13134363..13134429 1..67 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:10 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RA 1..438 74..511 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:43:14 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RB 1..438 74..511 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:49 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RB 1..438 74..511 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:35:22 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RA 1..438 74..511 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:02 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RB 1..438 74..511 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:17:41 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RA 1..770 1..766 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:43:14 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RB 1..766 1..766 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:49 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RB 1..766 1..766 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:35:22 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RA 1..770 1..766 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:02 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
CG12699-RB 1..766 1..766 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:04 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17246530..17247228 68..766 100 <- Minus
2R 17247317..17247383 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:04 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17246530..17247228 68..766 100 <- Minus
2R 17247317..17247383 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:04 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17246530..17247228 68..766 100 <- Minus
2R 17247317..17247383 1..67 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:49 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13134822..13134888 1..67 100   Minus
arm_2R 13134035..13134733 68..766 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:44 Download gff for GH14656.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17248516..17248582 1..67 100   Minus
2R 17247729..17248427 68..766 100 <- Minus

GH14656.pep Sequence

Translation from 73 to 510

> GH14656.pep
MSEEEAPGSPGEAVEEEDTTTSDADTTTAGARMMMIHPWLTAAAVAMYAT
KVMWVKFREIGLAKQEKRLKNQLAKQSKPLQTIDEDVSESDAEYDAESDA
ESDAESDAEDEDVVGPQVEDAAEGPGFEPNRVDICHRPIEVSTDC*

GH14656.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13413-PA 198 GF13413-PA 32..68 32..68 168 81.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:07:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22205-PA 132 GG22205-PA 10..132 8..145 239 52.5 Plus
Dere\GG22206-PA 146 GG22206-PA 1..119 1..119 220 48 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12699-PB 145 CG12699-PB 1..145 1..145 748 100 Plus
CG18469-PA 128 CG18469-PA 1..116 1..119 229 45.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19992-PA 143 GM19992-PA 1..143 1..145 395 71.8 Plus
Dsec\GM19993-PA 124 GM19993-PA 19..101 13..97 161 54.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25485-PA 131 GD25485-PA 19..113 13..113 169 49.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14203-PA 125 GE14203-PA 3..87 4..83 192 71.8 Plus
Dyak\GE14204-PA 133 GE14204-PA 14..95 11..101 185 54.9 Plus

GH14656.hyp Sequence

Translation from 215 to 679

> GH14656.hyp
MPPRSCGSSSVRSAWLNRKNGSKINWRSSLSPCRLLMKMFPNLMQNMMQN
LMQNLMQNQMQRTKTSSGPKSKMQQRDRDSSQTVWIYAIARSKSLLTADV
RIGDEGPRKDEHAHTHWTTTLIVVMLAFSVGEDPRTMFDMYHHIGGHKLL
VLKH*
Sequence GH14656.hyp has no blast hits.