Clone GH14674 Report

Search the DGRC for GH14674

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:146
Well:74
Vector:pOT2
Associated Gene/TranscriptCG33649-RA
Protein status:GH14674.pep2: gold GH14674.pep: gold
Preliminary Size:1492
Sequenced Size:1558

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8969 2001-01-01 Release 2 assignment
CG33084 2001-07-04 Blastp of sequenced clone
CG33084 2003-01-01 Sim4 clustering to Release 3
DNApol-gamma35 2008-04-29 Release 5.5 accounting
CG33649 2008-08-15 Release 5.9 accounting
DNApol-gamma35 2008-08-15 Release 5.9 accounting
DNApol-gamma35 2008-12-18 5.12 accounting
CG33649 2008-12-18 5.12 accounting

Clone Sequence Records

GH14674.complete Sequence

1558 bp (1558 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051491.1

> GH14674.complete
CTGGTGAGAATGTTGCGTCTGTTCAGCAGCCGTTTTTACTGCAAAATTGC
AACAAAATCGAATGAAAAGGCCACTAAATTGGACTTCAAGCAGCTAACGC
ATCCCACCAAGGTGCCACAGACACCAGTGGACTCGAAGTTTCCCGACACC
AGCGCCTCCGAAATCCAGATCGACACGAAAACCATCCAGTTGCTGGAGCG
GCTGTCGCTGGTGGATCTGGATAGCGAACGAGCGCTGGCCACGCTAAAGA
GCAGCATACAGTTCGCGGACAAGATTGCCCATATCAACACGGAGCACGTG
CGTCCACTGTACACGGTCCTGGAGCATCAGCAGCTCCAGTTACGCAACGA
CCAGGTGACCGAAGGCGATTGCCGGGCGGAGGTGCTCCGGAACGCCAAGG
TGACGGACGAGGACTACTTCGTTTCGCCGCCGGGCAACATTCCGCTGGAG
CAATGAGTCGCATACAACGATGCTTTAAGTCCCTGGCTTCCGCTGGCTTC
TTTCGCACCGTGGAAGACAATAAACTGGAGCTACTGAGTCATGGAAGGGA
ATACGCCAAACTGTTGCAACAGCATTGGACACGACTACGTCCCTTGGCTG
CGCACCTGGGCGCCACGAAAGAACCCATAAATCCAGTCAACATCCAGCGT
TTTTCCTTTCCACAAAGCCAGCAATTCCGTAACAATTTCCAAAAACTCGT
CAAAGATCATCCTCGAAAGGCCAAATGTCCCACTCTTCTGAAACATCAAA
GCACTTGTTCTGGTCCCACTAGCAATTCCCTATTTGGGATAAAGGGTCCT
ACGCTACATTTAACCACGGACTTCCTAGTGGAACCACATCGCGCACTGGA
GCACTTCTACAACATGCAGCGTGAGAGCAAGATCTGGTGGATGCGTCTTT
CCTCGAATCCCAGTCGCTACCGCATCGTACCTTGCGATTTGGCTGAGGAT
CTCAATCCCAACGACTATCAAGCCATCGATATCCGCACGAGCTACGGTGA
TGCAGGAGAAGTGACCGTGGAGCAACTGAGCCTGGTGAGAATAGTGGACG
ACAAAGACTTCCGGCTGCCCGATGCGCGAACGGGTGAAATTGTGCAACCG
ACTGTCATAAGGTCTGTGATAGAGCTGGAAACTACCACCTGCGCTCTGCT
TCTGGATGGCTGTGATCATGGCCGGGACTCGCAATCCCTGCTCTTACACC
GCGTTCTGGCGCCATATCAATGTGGAATTGCCTGTGTGGAAAGTGATTCC
GAGCTATCTGCTGACTTGTCTGATCTTTGTCAGCATCTGAAACATGTTCT
CAACCACGCCGGTCTTAGACTTTCTGAAGGGGATGGAATTCGTACGACGA
AGAACGCTTCTCATTTAGCAGAGCACTTGCTGGAAACGGATATGCTCGGC
ATACCTTATACACTTGTTATAAACGAGCAAACGCTAAGAAACGGACTGAT
GCAGTTGCGCAGCCGGGACACAAGGCTGGCGGAGACCATACACATAAGCG
ATGTACCGGACTATTTATTAAATATATTTAAAAACTAAAAAAAAAAAAAA
AAAAAAAA

GH14674.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG33649-RA 1634 CG33649-RA 88..1631 1..1544 7720 100 Plus
DNApol-gamma35-RA 1634 DNApol-gamma35-RA 88..1631 1..1544 7720 100 Plus
Orc5-RA 1837 Orc5-RA 1740..1837 1544..1447 490 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13830677..13831819 1143..1 5700 99.9 Minus
chr2L 23010047 chr2L 13830230..13830623 1536..1143 1970 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13831938..13833080 1143..1 5715 100 Minus
2L 23513712 2L 13831483..13831884 1544..1143 2010 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13831938..13833080 1143..1 5715 100 Minus
2L 23513712 2L 13831483..13831884 1544..1143 2010 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:24:18 has no hits.

GH14674.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:25:14 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13830256..13830622 1144..1510 100 <- Minus
chr2L 13830677..13831819 1..1143 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:15 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-gamma35-RA 1..1084 453..1536 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:26:35 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-gamma35-RA 1..1084 453..1536 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:22 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-gamma35-RA 1..1086 453..1538 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:59:44 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-gamma35-RA 1..1084 453..1536 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:33 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-gamma35-RA 1..1086 453..1538 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:25:36 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
CG33649-RA 88..1623 1..1536 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:26:35 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
CG33649-RA 88..1623 1..1536 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:22 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-gamma35-RA 26..1561 1..1536 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:59:44 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
CG33649-RA 88..1623 1..1536 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:33 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-gamma35-RA 26..1561 1..1536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:14 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13831491..13831883 1144..1536 100 <- Minus
2L 13831938..13833080 1..1143 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:14 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13831491..13831883 1144..1536 100 <- Minus
2L 13831938..13833080 1..1143 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:14 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13831491..13831883 1144..1536 100 <- Minus
2L 13831938..13833080 1..1143 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:22 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13831491..13831883 1144..1536 100 <- Minus
arm_2L 13831938..13833080 1..1143 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:37:34 Download gff for GH14674.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13831491..13831883 1144..1536 100 <- Minus
2L 13831938..13833080 1..1143 100   Minus

GH14674.pep2 Sequence

Translation from 9 to 455

> GH14674.pep2
MLRLFSSRFYCKIATKSNEKATKLDFKQLTHPTKVPQTPVDSKFPDTSAS
EIQIDTKTIQLLERLSLVDLDSERALATLKSSIQFADKIAHINTEHVRPL
YTVLEHQQLQLRNDQVTEGDCRAEVLRNAKVTDEDYFVSPPGNIPLEQ*

GH14674.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:17:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19721-PA 148 GF19721-PA 1..148 1..148 624 79.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10615-PA 158 GH10615-PA 1..155 1..148 569 74.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
GatC-PA 148 CG33649-PA 1..148 1..148 752 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17406-PA 125 GI17406-PA 6..125 29..148 504 80 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21081-PA 173 GL21081-PA 39..173 9..148 561 76.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29066-PA 148 GA29066-PA 1..148 1..148 634 79.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15071-PA 148 GM15071-PA 1..148 1..148 739 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22036-PA 148 GD22036-PA 1..148 1..148 753 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18086-PA 157 GJ18086-PA 1..157 1..148 574 73.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15009-PA 153 GK15009-PA 1..150 1..148 523 71.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11394-PA 148 GE11394-PA 1..148 1..148 738 93.9 Plus

GH14674.hyp Sequence

Translation from 452 to 1535

> GH14674.hyp
MSRIQRCFKSLASAGFFRTVEDNKLELLSHGREYAKLLQQHWTRLRPLAA
HLGATKEPINPVNIQRFSFPQSQQFRNNFQKLVKDHPRKAKCPTLLKHQS
TCSGPTSNSLFGIKGPTLHLTTDFLVEPHRALEHFYNMQRESKIWWMRLS
SNPSRYRIVPCDLAEDLNPNDYQAIDIRTSYGDAGEVTVEQLSLVRIVDD
KDFRLPDARTGEIVQPTVIRSVIELETTTCALLLDGCDHGRDSQSLLLHR
VLAPYQCGIACVESDSELSADLSDLCQHLKHVLNHAGLRLSEGDGIRTTK
NASHLAEHLLETDMLGIPYTLVINEQTLRNGLMQLRSRDTRLAETIHISD
VPDYLLNIFKN

GH14674.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-gamma35-PA 361 CG33650-PA 1..361 1..361 1893 100 Plus

GH14674.pep Sequence

Translation from 452 to 1537

> GH14674.pep
MSRIQRCFKSLASAGFFRTVEDNKLELLSHGREYAKLLQQHWTRLRPLAA
HLGATKEPINPVNIQRFSFPQSQQFRNNFQKLVKDHPRKAKCPTLLKHQS
TCSGPTSNSLFGIKGPTLHLTTDFLVEPHRALEHFYNMQRESKIWWMRLS
SNPSRYRIVPCDLAEDLNPNDYQAIDIRTSYGDAGEVTVEQLSLVRIVDD
KDFRLPDARTGEIVQPTVIRSVIELETTTCALLLDGCDHGRDSQSLLLHR
VLAPYQCGIACVESDSELSADLSDLCQHLKHVLNHAGLRLSEGDGIRTTK
NASHLAEHLLETDMLGIPYTLVINEQTLRNGLMQLRSRDTRLAETIHISD
VPDYLLNIFKN*

GH14674.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19722-PA 226 GF19722-PA 1..225 138..361 805 67.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10179-PA 361 GG10179-PA 1..361 1..361 1715 88.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10616-PA 376 GH10616-PA 3..375 2..361 1000 55.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-gamma35-PA 361 CG33650-PA 1..361 1..361 1893 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17407-PA 365 GI17407-PA 3..364 2..361 1042 57.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21082-PA 223 GL21082-PA 1..223 138..361 814 70.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17267-PA 223 GA17267-PA 1..223 138..361 807 69.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15082-PA 224 GM15082-PA 1..224 138..361 1131 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22037-PA 313 GD22037-PA 24..313 72..361 1467 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18087-PA 365 GJ18087-PA 3..364 2..361 978 56.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15010-PA 333 GK15010-PA 1..333 25..361 995 57.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11405-PA 224 GE11405-PA 1..224 138..361 1078 90.2 Plus