Clone GH14734 Report

Search the DGRC for GH14734

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:147
Well:34
Vector:pOT2
Associated Gene/TranscriptCG3088-RA
Protein status:GH14734.pep: gold
Preliminary Size:976
Sequenced Size:835

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3088 2001-01-01 Release 2 assignment
CG3088 2002-03-19 Blastp of sequenced clone
CG3088 2003-01-01 Sim4 clustering to Release 3
CG3088 2008-04-29 Release 5.5 accounting
CG3088 2008-08-15 Release 5.9 accounting
CG3088 2008-12-18 5.12 accounting

Clone Sequence Records

GH14734.complete Sequence

835 bp (835 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094713

> GH14734.complete
CATGAAGCTATTGGTAGTTTTCTTGGGTCTCACTCTCGTCGCAGCAGGAA
GTGCTAAGAAGGATTCCGAGGATCCTGATCACATTATAACCAATGGAAGC
CCCGCTTATGAAGGTCAGGCACCCTATGTGGTGGGCATGGCCTTTGGACA
GAGCAACATCTGGTGCAGTGGCACTATTATAGGCGACACCTGGATCCTTA
CATCCGCTCAGTGTCTAACGGGCAGTTCCGGAGTGACCATCTACTTTGGA
GCCACCCGGCTGAGTCAGGCCCAGTTTACGGTGACAGTGGGAACTAGTGA
GTACGTTACGGGTAATCAACATCTCGCCCTGGTTCGAGTTCCTCGAGTCG
GATTCAGCAACCGGGTCAACCGGGTGGCCCTTCCATCACTGAGAAATCGA
TCCCAGCGCTACGAGAACTGGTGGGCAAATGTCTGTGGATGGGGAGTGAC
CACCTTCAGCAATGGACTCACCGATGCGCTGCAATGCGTCGACCTTCAGA
TAATGTCCAATAACGAGTGTATCGCCTTCTACGGATCCACCACCGTCTCC
GATCAGATCCTGTGCACCCGTACGCCCAGCGGCAGATCCACTTGCTTTGG
CGATGCCGGCAGCCCCCTGATCACCAAACAGGATTCCACCGTGGTGGGCA
TTTCCGCATTTGTGGCCTCCAACGGGTGCACCTTGGGATTGCCCGCTGGA
TTTGCTAGGATCACCAGCGCACTGGATTGGATCCATCAAAGGACTGGAAT
CGCCTACTAATGGGTCAAATAGTAGCAACATTTAATAAAAAATGTCCAAT
ACCTGCATAGATATTTTAAAAAAAAAAAAAAAAAA

GH14734.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG3088-RA 825 CG3088-RA 9..825 1..817 4085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9592356..9593172 817..1 4070 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9600489..9601306 818..1 4090 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9593589..9594406 818..1 4090 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:55:06 has no hits.

GH14734.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:55:56 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9592356..9593172 1..817 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:31 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 1..759 2..760 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:03 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 1..759 2..760 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:49:05 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 1..759 2..760 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:26 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 1..759 2..760 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:22 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 1..759 2..760 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:09 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 9..825 1..817 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:03 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 20..836 1..817 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:49:05 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 20..836 1..817 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:26 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 9..825 1..817 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:22 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
CG3088-RA 20..836 1..817 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:56 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9600490..9601306 1..817 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:56 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9600490..9601306 1..817 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:56 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9600490..9601306 1..817 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:49:05 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9593590..9594406 1..817 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:11 Download gff for GH14734.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9593590..9594406 1..817 100   Minus

GH14734.pep Sequence

Translation from 1 to 759

> GH14734.pep
MKLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQ
SNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSE
YVTGNQHLALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVT
TFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFG
DAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRTGI
AY*

GH14734.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:27:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24652-PA 251 GF24652-PA 17..250 18..251 978 76.1 Plus
Dana\GF21539-PA 258 GF21539-PA 37..258 29..252 596 51.1 Plus
Dana\GF21537-PA 258 GF21537-PA 37..258 29..252 595 49.8 Plus
Dana\GF24394-PA 260 GF24394-PA 37..260 29..252 588 48.4 Plus
Dana\GF12374-PA 271 GF12374-PA 29..271 20..252 576 43.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14020-PA 252 GG14020-PA 1..252 1..252 1280 95.2 Plus
Dere\GG24338-PA 258 GG24338-PA 37..258 29..252 585 50.7 Plus
Dere\GG14309-PA 260 GG14309-PA 37..259 29..252 585 48.9 Plus
Dere\GG24336-PA 266 GG24336-PA 37..265 29..252 578 47.8 Plus
Dere\GG11754-PA 267 GG11754-PA 38..267 29..252 557 47.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12809-PA 260 GH12809-PA 1..260 1..252 610 47.1 Plus
Dgri\GH12831-PA 260 GH12831-PA 1..260 1..252 594 45.6 Plus
Dgri\GH15026-PA 259 GH15026-PA 36..259 29..252 591 50.2 Plus
Dgri\GH16310-PA 260 GH16310-PA 1..260 1..252 591 45.2 Plus
Dgri\GH15028-PA 268 GH15028-PA 1..268 1..252 590 43 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3088-PA 252 CG3088-PA 1..252 1..252 1324 100 Plus
Jon66Ci-PA 260 CG7118-PA 1..259 1..252 609 46.6 Plus
Jon25Bi-PB 266 CG8867-PB 1..265 1..252 607 46.1 Plus
Jon66Cii-PA 262 CG7170-PA 1..261 1..252 597 45.5 Plus
Jon25Bii-PB 276 CG8869-PB 43..276 29..252 594 47 Plus
Jon25Bii-PA 276 CG8869-PA 43..276 29..252 594 47 Plus
Jon25Biii-PA 258 CG8871-PA 3..258 6..252 592 47.5 Plus
Jon44E-PB 271 CG8579-PB 1..271 1..252 592 41.3 Plus
Jon44E-PA 271 CG8579-PA 1..271 1..252 592 41.3 Plus
Jon99Fi-PA 267 CG18030-PA 1..267 1..252 576 45 Plus
Jon99Fii-PA 267 CG2229-PA 3..267 4..252 575 44.8 Plus
Jon99Cii-PA 265 CG31034-PA 3..265 4..252 562 43.6 Plus
Jon99Ciii-PB 265 CG31362-PB 3..265 4..252 562 43.6 Plus
Jon99Ciii-PA 265 CG31362-PA 3..265 4..252 562 43.6 Plus
Jon99Ci-PA 272 CG31039-PA 41..272 29..252 537 42.2 Plus
Jon65Ai-PB 262 CG10475-PB 38..262 29..252 532 44.5 Plus
Jon65Ai-PA 262 CG10475-PA 38..262 29..252 532 44.5 Plus
Jon65Aii-PA 259 CG6580-PA 37..259 29..252 516 44.1 Plus
CG8329-PA 259 CG8329-PA 31..258 25..252 497 42.1 Plus
Jon65Aiii-PA 274 CG6483-PA 1..274 1..252 484 37.8 Plus
Jon65Aiv-PA 271 CG6467-PA 1..271 1..250 468 38.3 Plus
CG18180-PA 264 CG18180-PA 5..264 3..252 447 38.7 Plus
yip7-PA 270 CG6457-PA 40..270 29..250 445 39.9 Plus
CG18179-PA 268 CG18179-PA 33..268 22..252 432 40.5 Plus
CG10477-PB 272 CG10477-PB 37..272 26..252 430 37 Plus
CG10477-PA 272 CG10477-PA 37..272 26..252 430 37 Plus
CG7542-PB 270 CG7542-PB 2..260 1..244 402 38 Plus
CG7542-PA 270 CG7542-PA 2..260 1..244 402 38 Plus
CG10472-PA 290 CG10472-PA 43..285 25..250 308 33.2 Plus
CG8952-PA 276 CG8952-PA 9..275 8..251 303 32.6 Plus
CG11529-PA 287 CG11529-PA 47..260 43..249 289 28.9 Plus
Jon74E-PC 271 CG6298-PC 32..270 29..252 282 29.5 Plus
CG6592-PA 438 CG6592-PA 135..364 41..251 273 30.7 Plus
CG6462-PA 319 CG6462-PA 77..317 29..250 252 30.3 Plus
sphinx2-PC 253 CG32382-PC 1..253 1..252 242 27.7 Plus
sphinx2-PB 253 CG32382-PB 1..253 1..252 242 27.7 Plus
sphinx1-PB 253 CG32383-PB 1..253 1..252 238 29.4 Plus
CG32808-PA 284 CG32808-PA 10..255 4..244 216 28 Plus
CG4914-PA 374 CG4914-PA 128..360 29..244 199 25.2 Plus
CG11912-PA 271 CG11912-PA 1..266 1..246 197 27 Plus
CG9676-PA 251 CG9676-PA 9..251 10..250 190 23.4 Plus
CG11911-PA 277 CG11911-PA 1..266 1..244 188 30 Plus
CG17571-PB 258 CG17571-PB 3..255 2..248 187 27.8 Plus
CG17571-PA 258 CG17571-PA 3..255 2..248 187 27.8 Plus
CG7432-PB 721 CG7432-PB 475..719 29..248 187 25.8 Plus
CG9672-PA 253 CG9672-PA 3..250 4..247 179 28.6 Plus
Try29F-PD 267 CG9564-PD 14..267 3..250 178 26.5 Plus
Try29F-PC 267 CG9564-PC 14..267 3..250 178 26.5 Plus
Phae1-PB 270 CG16996-PB 32..263 25..244 178 27.2 Plus
Phae1-PA 270 CG16996-PA 32..263 25..244 178 27.2 Plus
CG16749-PA 265 CG16749-PA 30..257 29..244 174 24.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16680-PA 259 GI16680-PA 1..258 1..252 621 49.2 Plus
Dmoj\GI16705-PA 258 GI16705-PA 1..257 1..252 606 49.8 Plus
Dmoj\GI13254-PA 273 GI13254-PA 1..273 1..252 595 43.4 Plus
Dmoj\GI16703-PA 264 GI16703-PA 37..263 29..252 590 48.5 Plus
Dmoj\GI16704-PA 264 GI16704-PA 37..263 29..252 581 48.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10313-PA 250 GL10313-PA 20..250 22..252 858 68.4 Plus
Dper\GL26494-PA 276 GL26494-PA 1..276 1..252 604 43.7 Plus
Dper\GL19488-PA 258 GL19488-PA 37..258 29..252 585 50.7 Plus
Dper\GL24701-PA 239 GL24701-PA 16..239 29..252 577 47.6 Plus
Dper\GL17114-PA 272 GL17114-PA 43..272 29..252 564 45.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15917-PA 250 GA15917-PA 20..250 22..252 862 68.4 Plus
Dpse\GA21380-PA 276 GA21380-PA 1..276 1..252 602 43.9 Plus
Dpse\GA21381-PA 258 GA21381-PA 37..258 29..252 585 50.7 Plus
Dpse\GA20115-PA 260 GA20115-PA 37..260 29..252 573 47.1 Plus
Dpse\GA21379-PA 265 GA21379-PA 37..265 29..252 563 47.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24853-PA 252 GM24853-PA 1..252 1..252 1309 98.4 Plus
Dsec\GM24854-PA 207 GM24854-PA 1..207 46..252 1075 98.6 Plus
Dsec\GM24943-PA 262 GM24943-PA 1..261 1..252 592 45.1 Plus
Dsec\GM25051-PA 260 GM25051-PA 37..259 29..252 589 48.9 Plus
Dsec\GM18058-PA 252 GM18058-PA 37..252 29..252 530 47.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12907-PA 252 GD12907-PA 1..252 1..252 1312 98.8 Plus
Dsim\GD22676-PA 266 GD22676-PA 37..265 29..252 575 48.3 Plus
Dsim\GD10590-PA 271 GD10590-PA 1..271 1..252 574 42.8 Plus
Dsim\GD21522-PA 267 GD21522-PA 38..267 29..252 555 47.2 Plus
Dsim\GD11965-PA 265 GD11965-PA 36..265 29..252 548 46.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12444-PA 266 GJ12444-PA 27..265 20..252 591 46.9 Plus
Dvir\GJ12443-PA 257 GJ12443-PA 1..257 1..252 590 48.3 Plus
Dvir\GJ12442-PA 264 GJ12442-PA 37..263 29..252 580 48.5 Plus
Dvir\GJ12026-PA 266 GJ12026-PA 23..265 17..252 568 46.8 Plus
Dvir\GJ11121-PA 258 GJ11121-PA 37..258 29..252 564 52.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17287-PA 262 GK17287-PA 42..262 29..252 606 51.1 Plus
Dwil\GK17283-PA 263 GK17283-PA 39..262 29..252 596 48.4 Plus
Dwil\GK16899-PA 269 GK16899-PA 1..268 1..252 575 44.5 Plus
Dwil\GK17286-PA 260 GK17286-PA 40..260 29..252 574 48 Plus
Dwil\GK17284-PA 261 GK17284-PA 40..261 29..252 570 47.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21223-PA 255 GE21223-PA 1..255 1..252 1186 90.2 Plus
Dyak\GE21311-PA 264 GE21311-PA 1..263 1..252 621 45.5 Plus
Dyak\GE20738-PA 260 GE20738-PA 37..259 29..252 603 50.2 Plus
Dyak\GE18717-PA 258 GE18717-PA 37..258 29..252 584 50.7 Plus
Dyak\Ser4-PA 266 GE18715-PA 37..265 29..252 577 47.8 Plus

GH14734.hyp Sequence

Translation from 1 to 759

> GH14734.hyp
MKLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQ
SNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSE
YVTGNQHLALVRVPRVGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVT
TFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFG
DAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRTGI
AY*

GH14734.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG3088-PA 252 CG3088-PA 1..252 1..252 1324 100 Plus
Jon66Ci-PA 260 CG7118-PA 1..259 1..252 609 46.6 Plus
Jon25Bi-PB 266 CG8867-PB 1..265 1..252 607 46.1 Plus
Jon66Cii-PA 262 CG7170-PA 1..261 1..252 597 45.5 Plus
Jon25Bii-PB 276 CG8869-PB 43..276 29..252 594 47 Plus