Clone GH14779 Report

Search the DGRC for GH14779

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:147
Well:79
Vector:pOT2
Associated Gene/TranscriptCG7054-RA
Protein status:GH14779.pep: gold
Preliminary Size:967
Sequenced Size:847

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7054 2001-01-01 Release 2 assignment
CG7054 2001-10-10 Blastp of sequenced clone
CG7054 2003-01-01 Sim4 clustering to Release 3
CG7054 2008-04-29 Release 5.5 accounting
CG7054 2008-08-15 Release 5.9 accounting
CG7054 2008-12-18 5.12 accounting

Clone Sequence Records

GH14779.complete Sequence

847 bp (847 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060707

> GH14779.complete
ATTATTTCTAGGTGTTAGCTGTTGCCAGCGCTGGATAGCCTTGACTGGTT
TCGCCATCCAGATACTAATTAATTGGACTGGAAATTTTAATAAATCCGTA
GATATCCGCTGAATCAGAGTGAAGCTTTTGCTTTGTTATCACCCAGCTGG
CTTGGTCAGCAGAGTGATAACGCCACGAAAAAAAAACCGTATTATCATCT
TTTTGGGCTGACACGCTACACGTAACATGGATGACATAGTACCCGATGTG
CTGGATGCGGTTCCCGCTGGCACCATTAAGGTCATCTATGGCGATGACTT
GGAGGTCAAGCAGGGCAACGAGCTAACCCCCACCCAGGTGAAGGACCAAC
CGATTGTCAGCTGGTCTGGGCTGGAGGGAAAGTCCAACCTATTGACCCTG
CTCATGGTGGATCCCGATGCACCGACTCGTCAAGATCCCAAGTACCGTGA
GATTCTGCACTGGTCTGTGGTCAACATTCCCGGCAGCAATGAGAATCCTT
CTGGTGGCCACTCCCTAGCGGACTACGTTGGATCTGGACCGCCCAAGGAC
ACTGGCCTGCATCGGTATATTTTCCTCCTCTATCGCCAGGAGAACAAGAT
CGAGGAGACGCCCACTATATCCAATACTACTCGCACAGGCCGTTTGAACT
TCAACGCCCGGGACTTTGCCGCCAAACATGGATTGGGCGAGCCCATTGCC
GCCAATTATTACCAGGCCCAGTATGATGACTATGTGCCAATTCGGAATAA
AACGATCGTAGGCTAGATTTGTGCATATATCATGCAGGGTTTTCAATTCC
CCGTCAATAAAGTTTAACCAATTGCTTATAAAAAAAAAAAAAAAAAA

GH14779.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG7054-RA 999 CG7054-RA 137..965 1..829 4145 100 Plus
CG7054.a 892 CG7054.a 75..892 12..829 4090 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18288585..18289208 1..624 2985 98.6 Plus
chr3R 27901430 chr3R 18289273..18289474 628..829 980 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:52:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22465049..22465675 1..627 3135 100 Plus
3R 32079331 3R 22465737..22465938 628..829 1010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22205880..22206506 1..627 3135 100 Plus
3R 31820162 3R 22206568..22206769 628..829 1010 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:13:06 has no hits.

GH14779.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:13:44 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18288585..18289211 1..627 98 -> Plus
chr3R 18289273..18289474 628..829 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:38 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 1..540 227..766 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:52:01 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 1..540 227..766 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:53 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 1..540 227..766 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:21:15 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 1..540 227..766 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:18:21 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 1..540 227..766 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:37:00 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 137..965 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:52:01 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 137..965 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:53 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 65..893 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:21:16 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 137..965 1..829 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:18:21 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
CG7054-RA 65..893 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:44 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22465049..22465675 1..627 100 -> Plus
3R 22465737..22465938 628..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:44 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22465049..22465675 1..627 100 -> Plus
3R 22465737..22465938 628..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:44 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22465049..22465675 1..627 100 -> Plus
3R 22465737..22465938 628..829 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:53 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18290771..18291397 1..627 100 -> Plus
arm_3R 18291459..18291660 628..829 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:54 Download gff for GH14779.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22205880..22206506 1..627 100 -> Plus
3R 22206568..22206769 628..829 100   Plus

GH14779.hyp Sequence

Translation from 226 to 765

> GH14779.hyp
MDDIVPDVLDAVPAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLE
GKSNLLTLLMVDPDAPTRQDPKYREILHWSVVNIPGSNENPSGGHSLADY
VGSGPPKDTGLHRYIFLLYRQENKIEETPTISNTTRTGRLNFNARDFAAK
HGLGEPIAANYYQAQYDDYVPIRNKTIVG*

GH14779.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7054-PA 179 CG7054-PA 1..179 1..179 950 100 Plus
Pebp1-PA 176 CG18594-PA 6..175 4..177 477 49.4 Plus
CG17919-PA 202 CG17919-PA 29..199 4..177 457 50.3 Plus
CG6180-PA 257 CG6180-PA 85..255 4..177 442 52.6 Plus
CG10298-PA 187 CG10298-PA 13..185 4..179 422 48.6 Plus

GH14779.pep Sequence

Translation from 226 to 765

> GH14779.pep
MDDIVPDVLDAVPAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLE
GKSNLLTLLMVDPDAPTRQDPKYREILHWSVVNIPGSNENPSGGHSLADY
VGSGPPKDTGLHRYIFLLYRQENKIEETPTISNTTRTGRLNFNARDFAAK
HGLGEPIAANYYQAQYDDYVPIRNKTIVG*

GH14779.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23378-PA 175 GF23378-PA 1..175 1..179 695 75.4 Plus
Dana\GF16396-PA 202 GF16396-PA 29..200 4..178 472 52.3 Plus
Dana\GF23379-PA 176 GF23379-PA 6..168 4..170 468 51.5 Plus
Dana\GF14208-PA 260 GF14208-PA 88..258 4..177 453 52 Plus
Dana\GF16395-PA 186 GF16395-PA 13..185 4..179 449 52.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11138-PA 179 GG11138-PA 1..179 1..179 855 89.4 Plus
Dere\GG11139-PA 176 GG11139-PA 6..175 4..177 477 49.4 Plus
Dere\GG13347-PA 202 GG13347-PA 29..199 4..177 466 51.4 Plus
Dere\GG23796-PA 178 GG23796-PA 6..176 4..177 435 52 Plus
Dere\GG13336-PA 187 GG13336-PA 13..185 4..179 416 47.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22229-PA 177 GH22229-PA 1..177 1..179 571 61.1 Plus
Dgri\GH22236-PA 176 GH22236-PA 6..169 4..171 484 54.2 Plus
Dgri\GH14040-PA 202 GH14040-PA 29..199 4..177 458 50.9 Plus
Dgri\GH13213-PA 178 GH13213-PA 6..176 4..177 445 51.4 Plus
Dgri\GH14039-PA 186 GH14039-PA 13..185 4..179 437 46.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG7054-PA 179 CG7054-PA 1..179 1..179 950 100 Plus
Pebp1-PA 176 CG18594-PA 6..175 4..177 477 49.4 Plus
CG17919-PA 202 CG17919-PA 29..199 4..177 457 50.3 Plus
CG6180-PA 257 CG6180-PA 85..255 4..177 442 52.6 Plus
CG10298-PA 187 CG10298-PA 13..185 4..179 422 48.6 Plus
a5-PA 210 CG5430-PA 34..207 3..179 353 35.4 Plus
CG17917-PA 211 CG17917-PA 30..201 3..177 305 38.1 Plus
CG30060-PA 202 CG30060-PA 23..179 4..166 188 29.3 Plus
mRpL38-PA 416 CG15871-PA 146..311 12..168 153 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21977-PA 179 GI21977-PA 1..179 1..179 600 65.2 Plus
Dmoj\GI21978-PA 177 GI21978-PA 6..169 4..171 487 53.6 Plus
Dmoj\GI24413-PA 183 GI24413-PA 10..182 4..179 433 49.7 Plus
Dmoj\GI24414-PA 202 GI24414-PA 29..201 4..179 431 48 Plus
Dmoj\GI14504-PA 178 GI14504-PA 6..176 4..177 425 50.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24219-PA 179 GL24219-PA 1..179 1..179 658 66.9 Plus
Dper\GL24079-PA 203 GL24079-PA 30..200 4..177 482 53.1 Plus
Dper\GL19726-PA 256 GL19726-PA 84..254 4..177 444 52 Plus
Dper\GL24078-PA 189 GL24078-PA 14..187 3..179 427 48.9 Plus
Dper\GL24075-PA 220 GL24075-PA 34..205 3..177 340 40.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20063-PA 179 GA20063-PA 1..179 1..179 664 67.4 Plus
Dpse\GA14724-PA 203 GA14724-PA 30..200 4..177 485 53.1 Plus
Dpse\GA15006-PA 176 GA15006-PA 6..168 4..170 457 48.5 Plus
Dpse\GA19416-PA 256 GA19416-PA 84..254 4..177 443 52 Plus
Dpse\GA10227-PA 189 GA10227-PA 14..187 3..179 431 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26436-PA 179 GM26436-PA 1..179 1..179 902 95 Plus
Dsec\GM26437-PA 176 GM26437-PA 6..175 4..177 480 49.4 Plus
Dsec\GM10887-PA 202 GM10887-PA 29..199 4..177 452 50.3 Plus
Dsec\GM10048-PA 178 GM10048-PA 6..176 4..177 439 52.6 Plus
Dsec\GM10886-PA 187 GM10886-PA 13..185 4..179 404 48 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20953-PA 179 GD20953-PA 1..179 1..179 898 95.5 Plus
Dsim\GD20954-PA 176 GD20954-PA 6..175 4..177 477 49.4 Plus
Dsim\GD19866-PA 202 GD19866-PA 29..199 4..177 450 50.3 Plus
Dsim\GD23851-PA 178 GD23851-PA 6..176 4..177 439 52.6 Plus
Dsim\GD19865-PA 187 GD19865-PA 13..185 4..179 418 49.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14337-PA 179 GJ14337-PA 1..179 1..179 623 66.3 Plus
Dvir\GJ14338-PA 176 GJ14338-PA 6..169 4..171 475 53 Plus
Dvir\GJ16279-PA 226 GJ16279-PA 54..224 4..177 459 52.6 Plus
Dvir\GJ14272-PA 200 GJ14272-PA 27..198 3..177 457 49.4 Plus
Dvir\GJ14271-PA 186 GJ14271-PA 13..185 4..179 435 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11697-PA 182 GK11697-PA 1..182 1..179 548 61.4 Plus
Dwil\GK11701-PA 180 GK11701-PA 6..169 4..171 501 56.5 Plus
Dwil\GK11699-PA 174 GK11699-PA 6..167 4..171 492 55.4 Plus
Dwil\GK11698-PA 176 GK11698-PA 6..169 4..171 490 54.8 Plus
Dwil\GK13056-PA 202 GK13056-PA 28..199 4..177 475 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10304-PA 179 GE10304-PA 1..179 1..179 863 91.6 Plus
Dyak\GE10305-PA 176 GE10305-PA 6..175 4..177 474 49.4 Plus
Dyak\GE10211-PA 202 GE10211-PA 29..199 4..177 463 51.4 Plus
Dyak\GE18600-PA 178 GE18600-PA 6..176 4..177 440 52 Plus
Dyak\GE10210-PA 187 GE10210-PA 13..185 4..179 422 48 Plus