Clone GH14803 Report

Search the DGRC for GH14803

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:148
Well:3
Vector:pOT2
Associated Gene/Transcriptretinin-RA
Protein status:GH14803.pep: gold
Preliminary Size:1758
Sequenced Size:999

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13057 2001-09-19 Blastp of sequenced clone
CG13057 2003-01-01 Sim4 clustering to Release 3
retinin 2008-04-29 Release 5.5 accounting
retinin 2008-08-15 Release 5.9 accounting
retinin 2008-12-18 5.12 accounting

Clone Sequence Records

GH14803.complete Sequence

999 bp (999 high quality bases) assembled on 2001-09-19

GenBank Submission: AY059445

> GH14803.complete
AGAGCTTTGTGGTAAACAACTCGGCCTTCAACGGTTACCCCAGTCCGGGA
ATGGAGAACATAGCTAAGATAAACTCATCGTTCGAGTGCAGCTATTTGGT
GGGCAGCCGGAATGCCTATGGCCGCAGGCGCAAGTACTCTACGGATGAGC
CAGCAGGCGTGTGCACCACGCCTCGTGCCGAATTCGGCACGAGGCGGATC
TAAAGGAAGACTGCTATAATCATGTCTAGATTGTTCCTGCCCGTCTTGGC
CATTGTGCTGGTCTCCATCGGAGCTTCGCATACAGCCAGCTTGGAGTGGC
CCTCGAATCTTGTGGCTCTCAGTTCGGTCAAGTCCTCGCAGCTGCTTCCG
ATTGCCAGCGAGGATTCCGTTGAGTTGGCCGATGGCAGTTCGGGGTCCGT
CAGCTCATCCGCTGCCCAGCCGGAAGATCAATCCCAGGAGGAGGCGGAAG
AGCAACAGGTCTCCTCCGCATCCAGTGGCAGTGCCGATCCGATTAGTGGC
CGTCTTGTCTCTGCCGGAATTCCCGTCTCTGTGCCTCTTCCTCTGATCCT
GGCCGCTCGTAATGGACTACGAACCGTATTGACCATCCAGGAGCCAGCCG
TGGCCAAGGTGGGCGAGGTGGTGCAGCACGTGCCCACTGCCGTTTCGCAT
CAGACCCAGACGGTGGTGCACGATCACCGCCGATTGGTCACACCCATTGT
GGCACCCGCTGTTCGCACCACCCAGGTGATTCGCCAGCAGCCACCACTTC
TGTGGAGCGTGGCCTCCGATCCCCGAGTGGTTCTCATCCGCAACTAAGGA
TCCATTCAACAGATTAACACGATGAACTCGCCAAAGCTATGATACTTCTA
TTCTTAACTCCCTTTCTGGACCTAATAACCCACAAAAAGCTTTCTCCTCT
ACGTCTTCTTTCTTCTGCCATTTTCTGTAGATTTCTTCTGTAGCGTGCTT
TCAATAAAGATTTCGCATTTGCATTTAAAAAAAAAAAAAAAAAAAAAAA

GH14803.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
retinin-RA 894 retinin-RA 49..835 194..980 3935 100 Plus
Rbcn-3A-RA 10449 Rbcn-3A-RA 7790..7962 1..173 865 100 Plus
Rbcn-3A.b 10452 Rbcn-3A.b 7790..7962 1..173 865 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16321781..16322524 233..976 3720 100 Plus
chrX 22417052 chrX 6136590..6136762 173..1 865 100 Minus
chr3L 24539361 chr3L 16321683..16321722 194..233 200 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:53:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16332050..16332797 233..980 3740 100 Plus
X 23542271 X 6244402..6244574 173..1 865 100 Minus
3L 28110227 3L 16331952..16331991 194..233 200 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16325150..16325897 233..980 3740 100 Plus
X 23527363 X 6252500..6252672 173..1 865 100 Minus
3L 28103327 3L 16325052..16325091 194..233 200 100 Plus
3L 28103327 3L 16326617..16326668 603..654 140 84.6 Plus
Blast to na_te.dros performed 2019-03-16 06:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
Ddip\Bari1 1677 Ddip\Bari1 DDBARI1 1676bp Derived from Y13852. 1504..1560 876..934 128 71.2 Plus
Ddip\Bari1 1677 Ddip\Bari1 DDBARI1 1676bp Derived from Y13852. 61..117 934..876 110 67.8 Minus

GH14803.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:17:02 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16321683..16321722 194..233 100 -> Plus
chr3L 16321782..16322524 234..976 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:41 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 1..576 222..797 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:07:15 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 1..576 222..797 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:20 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 1..576 222..797 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:38:04 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 1..576 222..797 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:07 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 1..576 222..797 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:57:18 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 26..816 188..976 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:07:15 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 26..812 188..972 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:20 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 12..798 188..972 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:38:04 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 26..816 188..976 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:07 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
retinin-RA 12..798 188..972 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:02 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16331952..16331991 194..233 100 -> Plus
3L 16332051..16332793 234..976 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:02 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16331952..16331991 194..233 100 -> Plus
3L 16332051..16332793 234..976 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:02 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16331952..16331991 194..233 100 -> Plus
3L 16332051..16332793 234..976 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:20 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16325052..16325091 194..233 100 -> Plus
arm_3L 16325151..16325893 234..976 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:15:18 Download gff for GH14803.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16325052..16325091 194..233 100 -> Plus
3L 16325151..16325893 234..976 100   Plus

GH14803.pep Sequence

Translation from 221 to 796

> GH14803.pep
MSRLFLPVLAIVLVSIGASHTASLEWPSNLVALSSVKSSQLLPIASEDSV
ELADGSSGSVSSSAAQPEDQSQEEAEEQQVSSASSGSADPISGRLVSAGI
PVSVPLPLILAARNGLRTVLTIQEPAVAKVGEVVQHVPTAVSHQTQTVVH
DHRRLVTPIVAPAVRTTQVIRQQPPLLWSVASDPRVVLIRN*

GH14803.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24187-PA 194 GF24187-PA 1..194 1..191 665 79 Plus
Dana\GF24188-PA 98 GF24188-PA 35..81 123..169 137 57.4 Plus
Dana\GF10298-PA 145 GF10298-PA 25..85 107..170 136 48.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15991-PA 191 GG15991-PA 1..191 1..191 757 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15881-PA 184 GH15881-PA 1..184 1..191 425 53.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
retinin-PA 191 CG13057-PA 1..191 1..191 924 100 Plus
CG13043-PA 148 CG13043-PA 26..86 107..170 159 51.6 Plus
CG13063-PA 129 CG13063-PA 25..85 107..170 149 48.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16532-PA 183 GI16532-PA 1..183 1..191 510 58.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12009-PA 195 GA12009-PA 1..195 1..191 549 67.9 Plus
Dpse\GA12008-PA 100 GA12008-PA 35..88 123..180 138 51.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25623-PA 191 GM25623-PA 1..191 1..191 767 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14627-PA 175 GD14627-PA 4..175 20..191 754 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12785-PA 179 GJ12785-PA 1..179 1..191 528 60.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19556-PA 191 GE19556-PA 1..191 1..191 774 94.8 Plus
Dyak\GE23101-PA 191 GE23101-PA 1..191 1..191 774 94.8 Plus

GH14803.hyp Sequence

Translation from 221 to 796

> GH14803.hyp
MSRLFLPVLAIVLVSIGASHTASLEWPSNLVALSSVKSSQLLPIASEDSV
ELADGSSGSVSSSAAQPEDQSQEEAEEQQVSSASSGSADPISGRLVSAGI
PVSVPLPLILAARNGLRTVLTIQEPAVAKVGEVVQHVPTAVSHQTQTVVH
DHRRLVTPIVAPAVRTTQVIRQQPPLLWSVASDPRVVLIRN*

GH14803.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
retinin-PA 191 CG13057-PA 1..191 1..191 924 100 Plus
CG13043-PA 148 CG13043-PA 26..86 107..170 159 51.6 Plus
CG13063-PA 129 CG13063-PA 25..85 107..170 149 48.4 Plus