Clone GH14884 Report

Search the DGRC for GH14884

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:148
Well:84
Vector:pOT2
Associated Gene/TranscriptCG1814-RB
Protein status:GH14884.pep: gold
Preliminary Size:1633
Sequenced Size:1790

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1814 2001-09-19 Blastp of sequenced clone
CG1814 2003-01-01 Sim4 clustering to Release 3
CG1814 2008-04-29 Release 5.5 accounting
CG1814 2008-08-15 Release 5.9 accounting
CG1814 2008-12-18 5.12 accounting

Clone Sequence Records

GH14884.complete Sequence

1790 bp (1790 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058387

> GH14884.complete
CTCCTTCGGCAGAATGTGCTCCTGCGAGCTGGTGGTGTCCTCCGGAGCTG
GGACCCCATCTCCTCCAGCCTGTCCCCCTCGCCGTGCAAACCAAACTATA
GTTTCGAGGCGCGCGCTTTCGCGTCGGACGCTGGAGCTTCCGCTCCAGCT
GCAACCGCCCAGATCTCGCACCCAAAAACAGTGAGTGATTTCCAAAAGCT
TCACGAAGCCACCAAAAAGAAGTTCCAATCCAAGAAGCTGCCCTCCGATG
TGCATCCAGATGCGGTCTTCGCCTGCAACGAGCTCGATCTCAGCGAGGTG
CAGGTGTACGGATTCGATTACGACTACACGCTGGCCTGCTATAAGCCCAT
CCTGGAGGACCTGCTGTACAATCTGGCTCGCGAGATGCTGGTGAAGAGGT
TCCGCTACCCGGAGGACATCCTCCAGCTGGAGTACGAACCGAACTTTGCG
GTACGCGGCCTGCACTACGACGTGGAAAAGGGGCTGCTGGTGAAACTGGA
CAGTTTCCTGCAGCTACAGCTGGGCTCGGTATACAGGGGACGTACCAAAG
TGGAGGCGGATGAGGTGCTGAAGCTCTACCACAACCGCCTGCTGCCTATT
GCCTACGTGGAGGGGCCGAACAATAGCTACAGGCATAACACCAACTCCAA
AATGGTGCAATTGGCCGACCTGTTTTCTGTACCTGAAATGTGCCTGCTGT
GCAATGTAATCGAATATTTTGAACGCAATCGAATCGACTACAATCCAGAG
ATTGTTTTCCATGACACCAGGACCGCCATGGGCTCCTGCCATCCCATTAT
GCACGGCAAGGTGATGCGGAACACTGAGAAGTACATAGAACGAAACCCGA
AGCTGGTCAAGTTCTTCGAGAAGCTGCAGCAGGCGGGCAAGAATCTCTTT
CTAGTCACCAATAGCCCGTACTCGTTTGTAAACTGTGGCATGTCCTTTCT
GGTCGGCGCCAACTGGCGTGATTTCTTCGATGTGGTCATCGTGCAGGCCC
GCAAACCAAAGTTCTTTACGGATGAATCTCGACCAATAAGGCTATTCGAC
GAGCGAACGCAGTCACACCTATGGGATCGGGTATTCAAGCTGGAGAAGGG
AAAAATCTACTACGAGGGTTCGGTGAGACAGCTTCAAGAGCTGAAGGGCT
GGCGTGGTCACTCTGTGCTCTATTTCGGAGATCATCCGTACAGCGACCTA
GCAGATGTTACTCTGAAGCACAGCTGGAGGACAGGAGCCATTATTAGCGA
ACTGGCTCACGAAATTAAAACCCTCAATCGTAAGGACTTCAAGATGAGCG
CCAACTGGCTGCAAATGCTGACGCAGCTCATCGAGGACACCCAGGACGAT
GATAGCGAGGCAGCGCAGATCTGCCTAAAGGAGTGGATGGAGGAGCGGGA
TCAGTTGCGCAACAAAACGAAGAACGTGTTCAACGAGCAGTTTGGCAGCG
TTTTCCGCACCTACCACAACCCCACTTACTTCTCAAGACGCCTCTTCCGC
TTTGCCGACATCTACACCAGCGACATAACCAACCTGCTCAAGTTCTCCAC
CACCCACACCTTTTATCCCCGACGGGGTGTAATGCCCCACGAATATGCCT
CCCACTTTATCTAGAGAATTTGTGGGGACGAATGCCCGTTAGGAAGCTCA
GATTAGTTGTAGGTAACAAGAAGTGCCAGTGTTTAATGCTTGTAGCTCGA
AACTAGCGAATTTAATGCGTGTATATCGTTATTTACATTATTGCTCAATA
AAATCGTTGTAATAGTTCAAGAAAAAAAAAAAAAAAAAAA

GH14884.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG1814-RA 2018 CG1814-RA 222..1996 1..1775 8875 100 Plus
CG1814-RB 1969 CG1814-RB 402..1947 230..1775 7730 100 Plus
CG1814-RC 1673 CG1814-RC 132..1673 230..1771 7710 100 Plus
CG1814-RB 1969 CG1814-RB 222..401 1..180 900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5467458..5467861 230..633 2020 100 Plus
chr2R 21145070 chr2R 5468980..5469342 1409..1771 1815 100 Plus
chr2R 21145070 chr2R 5467946..5468242 633..929 1485 100 Plus
chr2R 21145070 chr2R 5467103..5467331 1..229 1145 100 Plus
chr2R 21145070 chr2R 5468313..5468500 930..1117 940 100 Plus
chr2R 21145070 chr2R 5468761..5468912 1258..1409 760 100 Plus
chr2R 21145070 chr2R 5468559..5468701 1115..1257 715 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:53:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9579963..9580366 230..633 2020 100 Plus
2R 25286936 2R 9581485..9581851 1409..1775 1835 100 Plus
2R 25286936 2R 9580451..9580747 633..929 1485 100 Plus
2R 25286936 2R 9579608..9579836 1..229 1145 100 Plus
2R 25286936 2R 9580818..9581005 930..1117 940 100 Plus
2R 25286936 2R 9581266..9581417 1258..1409 760 100 Plus
2R 25286936 2R 9581064..9581206 1115..1257 715 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9581162..9581565 230..633 2020 100 Plus
2R 25260384 2R 9582684..9583050 1409..1775 1835 100 Plus
2R 25260384 2R 9581650..9581946 633..929 1485 100 Plus
2R 25260384 2R 9580807..9581035 1..229 1145 100 Plus
2R 25260384 2R 9582017..9582204 930..1117 940 100 Plus
2R 25260384 2R 9582465..9582616 1258..1409 760 100 Plus
2R 25260384 2R 9582263..9582405 1115..1257 715 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:12:49 has no hits.

GH14884.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:14:02 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5468561..5468701 1117..1257 100 -> Plus
chr2R 5468761..5468912 1258..1409 100 -> Plus
chr2R 5468313..5468499 930..1116 100 -> Plus
chr2R 5467103..5467331 1..229 100 -> Plus
chr2R 5467458..5467861 230..633 100 -> Plus
chr2R 5467947..5468242 634..929 100 -> Plus
chr2R 5468981..5469342 1410..1771 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:43:48 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 34..1647 1..1614 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:07:04 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 34..1647 1..1614 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:05 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 34..1647 1..1614 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:37:49 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 34..1647 1..1614 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:22:26 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 34..1647 1..1614 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:57:02 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 157..1927 1..1771 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:07:03 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 157..1927 1..1771 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:05 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 159..1929 1..1771 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:37:49 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 157..1927 1..1771 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:22:26 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
CG1814-RA 159..1929 1..1771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:02 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9580818..9581004 930..1116 100 -> Plus
2R 9581066..9581206 1117..1257 100 -> Plus
2R 9581266..9581417 1258..1409 100 -> Plus
2R 9580452..9580747 634..929 100 -> Plus
2R 9579963..9580366 230..633 100 -> Plus
2R 9579608..9579836 1..229 100 -> Plus
2R 9581486..9581847 1410..1771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:02 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9580818..9581004 930..1116 100 -> Plus
2R 9581066..9581206 1117..1257 100 -> Plus
2R 9581266..9581417 1258..1409 100 -> Plus
2R 9580452..9580747 634..929 100 -> Plus
2R 9579963..9580366 230..633 100 -> Plus
2R 9579608..9579836 1..229 100 -> Plus
2R 9581486..9581847 1410..1771 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:02 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9580818..9581004 930..1116 100 -> Plus
2R 9581066..9581206 1117..1257 100 -> Plus
2R 9581266..9581417 1258..1409 100 -> Plus
2R 9580452..9580747 634..929 100 -> Plus
2R 9579963..9580366 230..633 100 -> Plus
2R 9579608..9579836 1..229 100 -> Plus
2R 9581486..9581847 1410..1771 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:05 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5468323..5468509 930..1116 100 -> Plus
arm_2R 5468571..5468711 1117..1257 100 -> Plus
arm_2R 5468771..5468922 1258..1409 100 -> Plus
arm_2R 5467957..5468252 634..929 100 -> Plus
arm_2R 5467113..5467341 1..229 100 -> Plus
arm_2R 5467468..5467871 230..633 100 -> Plus
arm_2R 5468991..5469352 1410..1771 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:15:04 Download gff for GH14884.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9580807..9581035 1..229 100 -> Plus
2R 9581162..9581565 230..633 100 -> Plus
2R 9581651..9581946 634..929 100 -> Plus
2R 9582017..9582203 930..1116 100 -> Plus
2R 9582265..9582405 1117..1257 100 -> Plus
2R 9582465..9582616 1258..1409 100 -> Plus
2R 9582685..9583046 1410..1771 100   Plus

GH14884.hyp Sequence

Translation from 1 to 1613

> GH14884.hyp
LLRQNVLLRAGGVLRSWDPISSSLSPSPCKPNYSFEARAFASDAGASAPA
ATAQISHPKTVSDFQKLHEATKKKFQSKKLPSDVHPDAVFACNELDLSEV
QVYGFDYDYTLACYKPILEDLLYNLAREMLVKRFRYPEDILQLEYEPNFA
VRGLHYDVEKGLLVKLDSFLQLQLGSVYRGRTKVEADEVLKLYHNRLLPI
AYVEGPNNSYRHNTNSKMVQLADLFSVPEMCLLCNVIEYFERNRIDYNPE
IVFHDTRTAMGSCHPIMHGKVMRNTEKYIERNPKLVKFFEKLQQAGKNLF
LVTNSPYSFVNCGMSFLVGANWRDFFDVVIVQARKPKFFTDESRPIRLFD
ERTQSHLWDRVFKLEKGKIYYEGSVRQLQELKGWRGHSVLYFGDHPYSDL
ADVTLKHSWRTGAIISELAHEIKTLNRKDFKMSANWLQMLTQLIEDTQDD
DSEAAQICLKEWMEERDQLRNKTKNVFNEQFGSVFRTYHNPTYFSRRLFR
FADIYTSDITNLLKFSTTHTFYPRRGVMPHEYASHFI*

GH14884.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG1814-PA 548 CG1814-PA 12..548 1..537 2848 100 Plus
CG1814-PC 462 CG1814-PC 2..462 77..537 2457 99.8 Plus
CG1814-PB 409 CG1814-PB 1..409 129..537 2182 100 Plus
CG32549-PD 581 CG32549-PD 29..481 89..531 491 29.8 Plus
CG32549-PF 612 CG32549-PF 60..512 89..531 491 29.8 Plus

GH14884.pep Sequence

Translation from 384 to 1613

> GH14884.pep
MLVKRFRYPEDILQLEYEPNFAVRGLHYDVEKGLLVKLDSFLQLQLGSVY
RGRTKVEADEVLKLYHNRLLPIAYVEGPNNSYRHNTNSKMVQLADLFSVP
EMCLLCNVIEYFERNRIDYNPEIVFHDTRTAMGSCHPIMHGKVMRNTEKY
IERNPKLVKFFEKLQQAGKNLFLVTNSPYSFVNCGMSFLVGANWRDFFDV
VIVQARKPKFFTDESRPIRLFDERTQSHLWDRVFKLEKGKIYYEGSVRQL
QELKGWRGHSVLYFGDHPYSDLADVTLKHSWRTGAIISELAHEIKTLNRK
DFKMSANWLQMLTQLIEDTQDDDSEAAQICLKEWMEERDQLRNKTKNVFN
EQFGSVFRTYHNPTYFSRRLFRFADIYTSDITNLLKFSTTHTFYPRRGVM
PHEYASHFI*

GH14884.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21341-PA 558 GF21341-PA 150..558 1..409 2161 96.3 Plus
Dana\GF22508-PA 378 GF22508-PA 76..360 8..281 309 27.9 Plus
Dana\GF10066-PA 536 GF10066-PA 144..454 2..293 196 23.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24086-PA 547 GG24086-PA 139..547 1..409 2215 99.3 Plus
Dere\GG18126-PA 713 GG18126-PA 209..614 8..403 407 27.5 Plus
Dere\GG14610-PA 534 GG14610-PA 143..452 2..293 225 25.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19932-PA 539 GH19932-PA 131..539 1..409 2084 91.9 Plus
Dgri\GH12351-PA 611 GH12351-PA 110..515 8..403 407 27.3 Plus
Dgri\GH16005-PA 445 GH16005-PA 44..354 2..290 230 24.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG1814-PB 409 CG1814-PB 1..409 1..409 2182 100 Plus
CG1814-PA 548 CG1814-PA 140..548 1..409 2182 100 Plus
CG1814-PC 462 CG1814-PC 54..462 1..409 2182 100 Plus
CG32549-PD 581 CG32549-PD 76..481 8..403 410 27.7 Plus
CG32549-PF 612 CG32549-PF 107..512 8..403 410 27.7 Plus
CG32549-PB 612 CG32549-PB 107..512 8..403 410 27.7 Plus
CG32549-PE 630 CG32549-PE 125..530 8..403 410 27.7 Plus
CG32549-PH 709 CG32549-PH 204..609 8..403 410 27.7 Plus
CG32549-PG 709 CG32549-PG 204..609 8..403 410 27.7 Plus
CG2277-PC 435 CG2277-PC 44..353 2..293 225 24.6 Plus
CG2277-PB 534 CG2277-PB 143..452 2..293 225 24.6 Plus
CG2277-PA 534 CG2277-PA 143..452 2..293 225 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19889-PA 537 GI19889-PA 129..537 1..409 2117 94.6 Plus
Dmoj\GI15598-PA 639 GI15598-PA 124..529 8..403 415 27.7 Plus
Dmoj\GI12272-PA 444 GI12272-PA 44..367 2..306 190 23.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17171-PA 499 GL17171-PA 91..499 1..409 2131 95.8 Plus
Dper\GL27036-PA 510 GL27036-PA 31..413 48..403 334 26.6 Plus
Dper\GL16077-PA 387 GL16077-PA 6..301 30..295 163 23.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25020-PB 551 GA25020-PB 143..551 1..409 2149 95.8 Plus
Dpse\GA25020-PC 409 GA25020-PC 1..409 1..409 2136 95.8 Plus
Dpse\GA22323-PA 576 GA22323-PA 74..479 8..403 412 27.5 Plus
Dpse\GA15339-PA 445 GA15339-PA 44..359 2..295 207 24.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21134-PA 481 GM21134-PA 140..481 1..342 1855 99.7 Plus
Dsec\GM22819-PA 637 GM22819-PA 133..538 8..403 410 27.5 Plus
Dsec\GM14224-PA 532 GM14224-PA 141..450 2..293 225 24.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10664-PA 548 GD10664-PA 140..548 1..409 2226 100 Plus
Dsim\GD15638-PA 403 GD15638-PA 52..349 8..294 339 29 Plus
Dsim\GD13486-PA 534 GD13486-PA 143..452 2..293 221 25.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15059-PA 538 GJ15059-PA 130..538 1..409 2121 93.9 Plus
Dvir\GJ15201-PA 634 GJ15201-PA 99..504 8..403 411 27.5 Plus
Dvir\GJ13208-PA 444 GJ13208-PA 44..367 2..306 175 22.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21823-PA 537 GK21823-PA 129..537 1..409 2117 94.4 Plus
Dwil\GK25265-PA 607 GK25265-PA 108..513 8..403 414 27.5 Plus
Dwil\GK20501-PA 430 GK20501-PA 44..428 2..406 202 22.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19287-PA 547 GE19287-PA 139..547 1..409 2221 99.5 Plus
Dyak\GE15532-PA 712 GE15532-PA 208..613 8..403 408 27.5 Plus
Dyak\GE20971-PA 535 GE20971-PA 144..453 2..293 219 25.9 Plus