BDGP Sequence Production Resources |
Search the DGRC for GH14950
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 149 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | Tsp42El-RA |
Protein status: | GH14950.pep: gold |
Preliminary Size: | 1034 |
Sequenced Size: | 1038 |
Gene | Date | Evidence |
---|---|---|
CG12840 | 2001-01-01 | Release 2 assignment |
CG12840 | 2001-07-04 | Blastp of sequenced clone |
CG12840 | 2003-01-01 | Sim4 clustering to Release 3 |
Tsp42El | 2008-04-29 | Release 5.5 accounting |
Tsp42El | 2008-08-15 | Release 5.9 accounting |
Tsp42El | 2008-12-18 | 5.12 accounting |
1038 bp (1038 high quality bases) assembled on 2001-07-04
GenBank Submission: AY051496
> GH14950.complete ACCGATTCAGTCAGGTTCCGCCGATACGGACTCAAAAACTGAAAATAATC GGCGGCACAGCAAACTGCCGCACTTGTGGCACTGCGATTCGGTTGCATTC TAGCCAAAGGCAAAAGTTTGAAGTGGAAAAACATTCGAAATGGGTTGCGC AACGGGCACCATAAAGTACTCGCTGTTCCTGTTCAATGCCTTATGGGCGA TACTCGGTATCCTGGTGCTCATCTTTGGCGGCCTTGGCTGGGGAGCAATG CCAGATGCATATGCCATCGGCATCTTAATTCTGGGCGGTACTATCCTGGT AATATCCCTGTTTGGATGCTGTGGAGCCGTTCGCGAATCGCCGCGCATGC TCTGGACGTATGCGTCACTGCTGCTGATTTTGCTGCTACTTATAGTGGCG TTTATCATCCTGAATCCCAAAGATGTATTTAAAAAGTACGCGCTTCAAAC GGTGGAGAATCAGTGGGAGCTGGAGCAGACGAAGCCTGGCAGTATGGATA TTATTCAGAAAACGTACTATTGCTGTGGCCGCGACAGTGCCCAAGACTAC TTGGATATCAAATTCTGGAACAATACCGTTCCAAGTAGCTGTTGCAAGGA CGACAGCTGTGTGAATCCACTGAATCTATATGTGCGCGGCTGCCTCATCA AAGTGGAGGAGGCTTTTGCAGATGAGGCAACCACTCTGGGCTATTTGGAG TGGGGTCTGCTCGGATTCAACGCTGTCATTCTATTGCTGGCCATCATCTT GGCCATTCACTACACCAACCGGCGGAGACGATATAACTATTAGTGAATAT TTACTGAATAAGAAACCAAACTCCTCAAATCTAAGTGTCATCAGTGTATG GTTTGTTTTTGATACGAAAACCCAGCGTTACTTGCCAAGCAACTGAGTTA ATCTTTTTATTAAAGCAATGTTTAACACATTCGAATATTAAAATAATATG TACATAACTACAAGTACCAAACACATGTCGTTTAAAATACCAAATATATT TAGAAAAATTACTTTCAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42El-RA | 1136 | Tsp42El-RA | 110..1127 | 1..1018 | 5090 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 2935648..2935942 | 722..1016 | 1445 | 99.3 | Plus |
chr2R | 21145070 | chr2R | 2935376..2935584 | 514..722 | 1045 | 100 | Plus |
chr2R | 21145070 | chr2R | 2933220..2933418 | 1..199 | 995 | 100 | Plus |
chr2R | 21145070 | chr2R | 2934681..2934840 | 199..358 | 785 | 99.4 | Plus |
chr2R | 21145070 | chr2R | 2934905..2935061 | 358..514 | 785 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 7048244..7048540 | 722..1018 | 1485 | 100 | Plus |
2R | 25286936 | 2R | 7047972..7048180 | 514..722 | 1045 | 100 | Plus |
2R | 25286936 | 2R | 7045815..7046013 | 1..199 | 995 | 100 | Plus |
2R | 25286936 | 2R | 7047276..7047435 | 199..358 | 800 | 100 | Plus |
2R | 25286936 | 2R | 7047500..7047656 | 358..514 | 785 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 7049443..7049739 | 722..1018 | 1485 | 100 | Plus |
2R | 25260384 | 2R | 7049171..7049379 | 514..722 | 1045 | 100 | Plus |
2R | 25260384 | 2R | 7047014..7047212 | 1..199 | 995 | 100 | Plus |
2R | 25260384 | 2R | 7048475..7048634 | 199..358 | 800 | 100 | Plus |
2R | 25260384 | 2R | 7048699..7048855 | 358..514 | 785 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dhyd\Minos | 1773 | Dhyd\Minos DHMINOS 1773bp Derived from Z29098. | 49..128 | 915..1000 | 125 | 70.1 | Plus |
Dhyd\Minos | 1773 | Dhyd\Minos DHMINOS 1773bp Derived from Z29098. | 1646..1725 | 1000..915 | 125 | 70.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 2933220..2933418 | 1..199 | 100 | -> | Plus |
chr2R | 2934682..2934840 | 200..358 | 99 | -> | Plus |
chr2R | 2934906..2935061 | 359..514 | 100 | -> | Plus |
chr2R | 2935377..2935583 | 515..721 | 100 | -> | Plus |
chr2R | 2935648..2935942 | 722..1016 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 1..654 | 140..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 1..654 | 140..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 1..654 | 140..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 1..654 | 140..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 1..654 | 140..793 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 43..1058 | 1..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 43..1058 | 1..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 47..1062 | 1..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 43..1058 | 1..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tsp42El-RA | 47..1062 | 1..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7047277..7047435 | 200..358 | 100 | -> | Plus |
2R | 7047501..7047656 | 359..514 | 100 | -> | Plus |
2R | 7047973..7048179 | 515..721 | 100 | -> | Plus |
2R | 7045815..7046013 | 1..199 | 100 | -> | Plus |
2R | 7048244..7048538 | 722..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7047277..7047435 | 200..358 | 100 | -> | Plus |
2R | 7047501..7047656 | 359..514 | 100 | -> | Plus |
2R | 7047973..7048179 | 515..721 | 100 | -> | Plus |
2R | 7045815..7046013 | 1..199 | 100 | -> | Plus |
2R | 7048244..7048538 | 722..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7047277..7047435 | 200..358 | 100 | -> | Plus |
2R | 7047501..7047656 | 359..514 | 100 | -> | Plus |
2R | 7047973..7048179 | 515..721 | 100 | -> | Plus |
2R | 7045815..7046013 | 1..199 | 100 | -> | Plus |
2R | 7048244..7048538 | 722..1016 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 2935749..2936043 | 722..1016 | 100 | Plus | |
arm_2R | 2933320..2933518 | 1..199 | 100 | -> | Plus |
arm_2R | 2934782..2934940 | 200..358 | 100 | -> | Plus |
arm_2R | 2935006..2935161 | 359..514 | 100 | -> | Plus |
arm_2R | 2935478..2935684 | 515..721 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 7049172..7049378 | 515..721 | 100 | -> | Plus |
2R | 7049443..7049737 | 722..1016 | 100 | Plus | |
2R | 7047014..7047212 | 1..199 | 100 | -> | Plus |
2R | 7048476..7048634 | 200..358 | 100 | -> | Plus |
2R | 7048700..7048855 | 359..514 | 100 | -> | Plus |
Translation from 139 to 792
> GH14950.hyp MGCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMPDAYAIGILILGG TILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKY ALQTVENQWELEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSS CCKDDSCVNPLNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLL AIILAIHYTNRRRRYNY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42El-PA | 217 | CG12840-PA | 1..217 | 1..217 | 1150 | 100 | Plus |
Tsp42Ee-PB | 228 | CG10106-PB | 1..228 | 1..217 | 330 | 36.1 | Plus |
Tsp42Ee-PA | 228 | CG10106-PA | 1..228 | 1..217 | 330 | 36.1 | Plus |
Tsp42Ek-PB | 215 | CG12841-PB | 1..215 | 1..217 | 301 | 33.3 | Plus |
Tsp42Ek-PA | 215 | CG12841-PA | 1..215 | 1..217 | 301 | 33.3 | Plus |
Translation from 139 to 792
> GH14950.pep MGCATGTIKYSLFLFNALWAILGILVLIFGGLGWGAMPDAYAIGILILGG TILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNPKDVFKKY ALQTVENQWELEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFWNNTVPSS CCKDDSCVNPLNLYVRGCLIKVEEAFADEATTLGYLEWGLLGFNAVILLL AIILAIHYTNRRRRYNY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12689-PA | 217 | GF12689-PA | 1..217 | 1..217 | 877 | 81.1 | Plus |
Dana\GF12682-PA | 227 | GF12682-PA | 1..227 | 1..217 | 325 | 35.8 | Plus |
Dana\GF13154-PA | 226 | GF13154-PA | 1..226 | 1..217 | 294 | 34.3 | Plus |
Dana\GF12688-PA | 215 | GF12688-PA | 1..215 | 1..217 | 286 | 30.1 | Plus |
Dana\GF12681-PA | 228 | GF12681-PA | 1..228 | 1..217 | 267 | 30.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23251-PA | 217 | GG23251-PA | 1..217 | 1..217 | 977 | 88 | Plus |
Dere\GG23249-PA | 215 | GG23249-PA | 1..215 | 1..217 | 297 | 34.2 | Plus |
Dere\GG10779-PA | 227 | GG10779-PA | 1..227 | 1..217 | 271 | 31.3 | Plus |
Dere\GG23243-PA | 228 | GG23243-PA | 1..228 | 1..217 | 267 | 35.3 | Plus |
Dere\GG23252-PA | 208 | GG23252-PA | 1..208 | 1..217 | 252 | 31.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21507-PA | 217 | GH21507-PA | 1..217 | 1..217 | 770 | 72.4 | Plus |
Dgri\GH21512-PA | 218 | GH21512-PA | 1..218 | 1..217 | 322 | 37.5 | Plus |
Dgri\GH21499-PA | 230 | GH21499-PA | 1..230 | 1..217 | 306 | 34.3 | Plus |
Dgri\GH21506-PA | 217 | GH21506-PA | 1..215 | 1..217 | 293 | 32.9 | Plus |
Dgri\GH21494-PA | 226 | GH21494-PA | 1..226 | 1..217 | 291 | 33.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tsp42El-PA | 217 | CG12840-PA | 1..217 | 1..217 | 1150 | 100 | Plus |
Tsp42Ee-PB | 228 | CG10106-PB | 1..228 | 1..217 | 330 | 36.1 | Plus |
Tsp42Ee-PA | 228 | CG10106-PA | 1..228 | 1..217 | 330 | 36.1 | Plus |
Tsp42Ek-PB | 215 | CG12841-PB | 1..215 | 1..217 | 301 | 33.3 | Plus |
Tsp42Ek-PA | 215 | CG12841-PA | 1..215 | 1..217 | 301 | 33.3 | Plus |
Tsp42Ea-PC | 226 | CG18817-PC | 1..226 | 1..217 | 291 | 33.5 | Plus |
Tsp42Ea-PB | 226 | CG18817-PB | 1..226 | 1..217 | 291 | 33.5 | Plus |
Tsp42Ea-PA | 226 | CG18817-PA | 1..226 | 1..217 | 291 | 33.5 | Plus |
Tsp42Ed-PB | 227 | CG12846-PB | 1..227 | 1..217 | 265 | 30.5 | Plus |
Tsp42Ed-PA | 227 | CG12846-PA | 1..227 | 1..217 | 265 | 30.5 | Plus |
lbm-PB | 208 | CG2374-PB | 1..208 | 1..217 | 257 | 32 | Plus |
lbm-PA | 208 | CG2374-PA | 1..208 | 1..217 | 257 | 32 | Plus |
Tsp42Eq-PA | 219 | CG12832-PA | 1..218 | 1..217 | 245 | 27.5 | Plus |
Tsp42Eh-PB | 231 | CG12844-PB | 1..229 | 1..217 | 242 | 26.3 | Plus |
Tsp42Ei-PB | 229 | CG12843-PB | 1..225 | 1..216 | 239 | 28.1 | Plus |
Tsp42Ei-PA | 229 | CG12843-PA | 1..225 | 1..216 | 239 | 28.1 | Plus |
Tsp42Ec-PA | 232 | CG12847-PA | 1..214 | 1..201 | 237 | 29.5 | Plus |
Tsp42Er-PA | 211 | CG12837-PA | 1..211 | 1..217 | 208 | 27.3 | Plus |
CG30160-PA | 222 | CG30160-PA | 1..216 | 1..205 | 208 | 28.3 | Plus |
Tsp42Eb-PB | 222 | CG18816-PB | 1..216 | 1..205 | 208 | 28.3 | Plus |
Tsp47F-PB | 239 | CG9033-PB | 4..235 | 3..214 | 208 | 30.5 | Plus |
Tsp42Eo-PA | 219 | CG12838-PA | 8..219 | 8..217 | 196 | 26.9 | Plus |
Tsp42Ef-PA | 220 | CG12845-PA | 3..217 | 4..214 | 186 | 23.4 | Plus |
Tsp42En-PB | 218 | CG12839-PB | 1..218 | 1..217 | 183 | 26.1 | Plus |
Tsp42En-PA | 218 | CG12839-PA | 1..218 | 1..217 | 183 | 26.1 | Plus |
Tsp39D-PB | 235 | CG8666-PB | 9..234 | 8..217 | 176 | 25.9 | Plus |
Tsp42Eg-PA | 218 | CG12142-PA | 1..215 | 1..217 | 171 | 28.6 | Plus |
Tsp42Ep-PB | 250 | CG4471-PB | 3..218 | 2..214 | 167 | 29.6 | Plus |
Tsp42Ep-PA | 250 | CG4471-PA | 3..218 | 2..214 | 167 | 29.6 | Plus |
Tsp29Fa-PC | 248 | CG9494-PC | 7..171 | 4..152 | 166 | 29.6 | Plus |
Tsp29Fa-PB | 248 | CG9494-PB | 7..171 | 4..152 | 166 | 29.6 | Plus |
Tsp29Fa-PA | 248 | CG9494-PA | 7..171 | 4..152 | 166 | 29.6 | Plus |
Tsp5D-PB | 283 | CG4690-PB | 50..265 | 35..217 | 147 | 24.9 | Plus |
Tsp5D-PA | 283 | CG4690-PA | 50..265 | 35..217 | 147 | 24.9 | Plus |
Tsp5D-PC | 287 | CG4690-PC | 50..265 | 35..217 | 147 | 24.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19476-PA | 217 | GI19476-PA | 1..217 | 1..217 | 758 | 74.2 | Plus |
Dmoj\GI19469-PA | 231 | GI19469-PA | 1..231 | 1..217 | 338 | 36.1 | Plus |
Dmoj\GI19481-PA | 220 | GI19481-PA | 1..220 | 1..217 | 308 | 32.1 | Plus |
Dmoj\GI19475-PA | 217 | GI19475-PA | 1..215 | 1..217 | 299 | 30.6 | Plus |
Dmoj\GI19464-PA | 226 | GI19464-PA | 1..226 | 1..217 | 293 | 33.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11146-PA | 217 | GL11146-PA | 1..217 | 1..217 | 951 | 82.9 | Plus |
Dper\GL11133-PA | 226 | GL11133-PA | 1..226 | 1..217 | 305 | 35.2 | Plus |
Dper\GL11145-PA | 215 | GL11145-PA | 1..215 | 1..217 | 299 | 33.3 | Plus |
Dper\GL11138-PA | 252 | GL11138-PA | 1..252 | 1..217 | 286 | 33.1 | Plus |
Dper\GL11142-PA | 228 | GL11142-PA | 1..224 | 1..216 | 271 | 31.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11846-PA | 217 | GA11846-PA | 1..217 | 1..217 | 956 | 83.4 | Plus |
Dpse\GA10076-PA | 228 | GA10076-PA | 1..228 | 1..217 | 322 | 36.5 | Plus |
Dpse\GA15095-PA | 226 | GA15095-PA | 1..226 | 1..217 | 305 | 35.2 | Plus |
Dpse\GA11847-PA | 215 | GA11847-PA | 1..215 | 1..217 | 297 | 32.9 | Plus |
Dpse\GA24622-PA | 228 | GA24622-PA | 1..224 | 1..216 | 271 | 31.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20924-PA | 217 | GM20924-PA | 1..217 | 1..217 | 1025 | 95.9 | Plus |
Dsec\GM16190-PA | 228 | GM16190-PA | 1..228 | 1..217 | 286 | 37 | Plus |
Dsec\GM18744-PA | 228 | GM18744-PA | 1..228 | 1..217 | 286 | 37 | Plus |
Dsec\GM20915-PA | 228 | GM20915-PA | 1..228 | 1..217 | 285 | 36.5 | Plus |
Dsec\GM20925-PA | 208 | GM20925-PA | 1..208 | 1..217 | 263 | 32.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10452-PA | 217 | GD10452-PA | 1..217 | 1..217 | 1105 | 96.8 | Plus |
Dsim\GD10451-PA | 215 | GD10451-PA | 1..215 | 1..217 | 286 | 33.6 | Plus |
Dsim\GD10444-PA | 228 | GD10444-PA | 1..228 | 1..217 | 284 | 36.5 | Plus |
Dsim\GD10280-PA | 227 | GD10280-PA | 1..227 | 1..217 | 262 | 30.5 | Plus |
Dsim\GD10276-PA | 219 | GD10276-PA | 1..218 | 1..217 | 250 | 28.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15137-PA | 217 | GJ15137-PA | 1..217 | 1..217 | 800 | 74.2 | Plus |
Dvir\GJ15136-PA | 217 | GJ15136-PA | 1..215 | 1..217 | 320 | 32.4 | Plus |
Dvir\GJ15128-PA | 230 | GJ15128-PA | 1..230 | 1..217 | 305 | 36.5 | Plus |
Dvir\GJ15124-PA | 226 | GJ15124-PA | 1..226 | 1..217 | 294 | 34.3 | Plus |
Dvir\GJ15138-PA | 208 | GJ15138-PA | 1..208 | 1..217 | 274 | 30.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21783-PA | 217 | GK21783-PA | 1..217 | 1..217 | 928 | 77.9 | Plus |
Dwil\GK21787-PA | 215 | GK21787-PA | 1..215 | 1..217 | 304 | 33.5 | Plus |
Dwil\GK21776-PA | 228 | GK21776-PA | 1..228 | 1..217 | 297 | 34.3 | Plus |
Dwil\GK21782-PA | 216 | GK21782-PA | 1..216 | 1..217 | 294 | 32 | Plus |
Dwil\GK21771-PA | 226 | GK21771-PA | 1..226 | 1..217 | 288 | 33.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19101-PA | 217 | GE19101-PA | 1..217 | 1..217 | 992 | 94.5 | Plus |
Dyak\GE19100-PA | 215 | GE19100-PA | 1..215 | 1..217 | 284 | 33.3 | Plus |
Dyak\Tsp42Ee-PA | 228 | GE19093-PA | 1..228 | 1..217 | 267 | 34.8 | Plus |
Dyak\Tsp42Ed-PA | 227 | GE24279-PA | 1..227 | 1..217 | 263 | 30.9 | Plus |
Dyak\GE19102-PA | 208 | GE19102-PA | 1..208 | 1..217 | 258 | 32.1 | Plus |