Clone GH15170 Report

Search the DGRC for GH15170

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:151
Well:70
Vector:pOT2
Associated Gene/TranscriptCG11459-RA
Protein status:GH15170.pep: gold
Preliminary Size:1213
Sequenced Size:1119

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11459 2001-01-01 Release 2 assignment
CG11459 2003-01-01 Sim4 clustering to Release 3
CG11459 2003-01-15 Blastp of sequenced clone
CG11459 2008-04-29 Release 5.5 accounting
CG11459 2008-08-15 Release 5.9 accounting
CG11459 2008-12-18 5.12 accounting

Clone Sequence Records

GH15170.complete Sequence

1119 bp (1119 high quality bases) assembled on 2003-01-15

GenBank Submission: AY060710

> GH15170.complete
AATGGGCACGCCTCGTCTGACCGTAGTACACGGTCTAATCCTTCTGCTCC
TTGTGGAGCTAGGTTTGACTGCGGTCAGCGATACGGAGTGGGACCAGTAC
AAGGCTAAGTACAACAAGCAGTACAGGAACAGGGACAAATACCACCGGGC
GCTATACGAACAGAGGGTCCTGGCGGTGGAAAGCCACAACCAGCTCTATT
TGCAGGGAAAGGTTGCATTCAAGATGGGACTAAACAAGTTCTCCGACACA
GATCAGAGAATCCTCTTCAATTATCGCTCGTCGATCCCAGCGCCGCTGGA
GACGAGTACCAATGCACTTACGGAGACTGTAAACTACAAGAGGTACGACC
AGATCACCGAAGGAATCGACTGGCGGCAGTACGGCTATATATCGCCAGTG
GGAGACCAGGGCACCGAGTGCCTGAGCTGCTGGGCCTTCTCCACCTCGGG
TGTTCTTGAGGCACATATGGCGAAGAAGTATGGAAATCTGGTTCCCCTTT
CACCCAAGCACTTGGTGGACTGTGTTCCCTATCCGAATAACGGCTGCAGC
GGTGGTTGGGTGAGCGTGGCCTTTAACTACACCAGGGACCATGGCATCGC
CACAAAGGAATCCTATCCGTACGAGCCTGTATCAGGAGAATGCCTGTGGA
AAAGCGACAGAAGTGCAGGCACATTGTCGGGCTACGTCACTCTCGGCAAC
TACGATGAACGGGAACTGGCGGAGGTGGTCTACAACATTGGACCCGTGGC
GGTGTCCATTGACCATCTCCACGAGGAATTCGATCAGTACTCCGGTGGAG
TCCTCAGTATTCCGGCGTGCAGATCTAAGAGACAGGACCTTACACACTCC
GTTCTTTTAGTCGGCTTTGGAACCCATCGGAAGTGGGGAGACTACTGGAT
AATAAAGAACTCCTATGGAACCGATTGGGGAGAAAGTGGCTACTTAAAGC
TAGCTCGGAACGCCAACAACATGTGTGGAGTGGCATCACTTCCCCAATAT
CCCACTTTTTGAATAAAATCGTAGAGAAATATGATGTCAGTAGGATCATA
TCTCCCAGTTGAAATAAACGTATTTTATATCGCTTTTGAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

GH15170.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11459-RA 1131 CG11459-RA 38..1125 1..1088 5440 100 Plus
CG1075-RA 825 CG1075-RA 633..764 844..974 410 88.6 Plus
CG1075-RA 825 CG1075-RA 254..416 464..627 360 82.3 Plus
CG1075-RA 825 CG1075-RA 450..587 661..798 345 83.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1851730..1852817 1088..1 5440 100 Minus
chr3R 27901430 chr3R 1853617..1854235 384..1002 1380 82.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:53:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6026116..6027203 1088..1 5440 100 Minus
3R 32079331 3R 6028003..6028621 384..1002 1380 82.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5766947..5768034 1088..1 5440 100 Minus
3R 31820162 3R 5768834..5769076 384..627 700 86.4 Plus
3R 31820162 3R 5769293..5769452 844..1002 505 88.7 Plus
3R 31820162 3R 5769110..5769247 661..798 345 83.3 Plus
Blast to na_te.dros performed on 2019-03-16 00:41:51 has no hits.

GH15170.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:34 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1851730..1852817 1..1088 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:44:11 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 1..1011 2..1012 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:33 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 1..1011 2..1012 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:53 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 1..1011 2..1012 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:27 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 1..1011 2..1012 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:10:35 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 1..1011 2..1012 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:19 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 38..1125 1..1088 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:33 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 38..1125 1..1088 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:53 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 36..1123 1..1088 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:28 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 38..1125 1..1088 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:10:35 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
CG11459-RA 36..1123 1..1088 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:34 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6026116..6027203 1..1088 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:34 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6026116..6027203 1..1088 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:34 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6026116..6027203 1..1088 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:53 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1851838..1852925 1..1088 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:43 Download gff for GH15170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5766947..5768034 1..1088 100   Minus

GH15170.hyp Sequence

Translation from 0 to 1011

> GH15170.hyp
MGTPRLTVVHGLILLLLVELGLTAVSDTEWDQYKAKYNKQYRNRDKYHRA
LYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILFNYRSSIPAPLE
TSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSG
VLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIA
TKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVA
VSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWI
IKNSYGTDWGESGYLKLARNANNMCGVASLPQYPTF*

GH15170.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG11459-PB 336 CG11459-PB 1..336 1..336 1818 100 Plus
CG11459-PA 336 CG11459-PA 1..336 1..336 1818 100 Plus
Cp1-PC 371 CG6692-PC 30..369 3..334 603 37.9 Plus
Cp1-PA 341 CG6692-PA 2..339 5..334 600 37.8 Plus
Cp1-PE 338 CG6692-PE 36..336 38..334 578 39.1 Plus

GH15170.pep Sequence

Translation from 1 to 1011

> GH15170.pep
MGTPRLTVVHGLILLLLVELGLTAVSDTEWDQYKAKYNKQYRNRDKYHRA
LYEQRVLAVESHNQLYLQGKVAFKMGLNKFSDTDQRILFNYRSSIPAPLE
TSTNALTETVNYKRYDQITEGIDWRQYGYISPVGDQGTECLSCWAFSTSG
VLEAHMAKKYGNLVPLSPKHLVDCVPYPNNGCSGGWVSVAFNYTRDHGIA
TKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELAEVVYNIGPVA
VSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWI
IKNSYGTDWGESGYLKLARNANNMCGVASLPQYPTF*

GH15170.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17600-PA 333 GF17600-PA 9..331 12..334 605 38.7 Plus
Dana\GF13722-PA 417 GF13722-PA 121..415 44..334 581 40.3 Plus
Dana\GF13714-PA 352 GF13714-PA 38..352 30..336 482 34.1 Plus
Dana\GF17358-PA 329 GF17358-PA 3..327 5..334 469 32.9 Plus
Dana\GF14107-PA 338 GF14107-PA 2..335 5..333 451 30.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10644-PA 344 GG10644-PA 1..341 1..334 1338 76.5 Plus
Dere\GG20414-PA 341 GG20414-PA 28..339 29..334 602 39.2 Plus
Dere\GG20405-PA 352 GG20405-PA 9..352 6..336 471 32.6 Plus
Dere\GG20691-PA 378 GG20691-PA 87..376 49..334 442 34.6 Plus
Dere\GG23942-PA 338 GG23942-PA 34..335 28..333 439 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22826-PA 340 GH22826-PA 3..338 7..334 625 39 Plus
Dgri\GH20767-PA 329 GH20767-PA 25..327 28..334 501 35.3 Plus
Dgri\GH21038-PA 349 GH21038-PA 125..349 116..336 474 40 Plus
Dgri\GH23906-PA 358 GH23906-PA 69..356 46..334 431 34.1 Plus
Dgri\GH21411-PA 391 GH21411-PA 102..389 46..334 430 34.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11459-PB 336 CG11459-PB 1..336 1..336 1818 100 Plus
CG11459-PA 336 CG11459-PA 1..336 1..336 1818 100 Plus
Cp1-PC 371 CG6692-PC 30..369 3..334 603 37.9 Plus
Cp1-PA 341 CG6692-PA 2..339 5..334 600 37.8 Plus
Cp1-PE 338 CG6692-PE 36..336 38..334 578 39.1 Plus
Cp1-PD 249 CG6692-PD 32..247 118..334 522 46.1 Plus
CG6347-PA 352 CG6347-PA 38..350 30..334 486 34.3 Plus
CG4847-PE 390 CG4847-PE 102..388 48..334 449 35.4 Plus
CG4847-PC 390 CG4847-PC 102..388 48..334 449 35.4 Plus
CG4847-PA 390 CG4847-PA 102..388 48..334 449 35.4 Plus
CG4847-PD 420 CG4847-PD 132..418 48..334 449 35.4 Plus
CG5367-PA 338 CG5367-PA 34..335 28..333 435 32.2 Plus
26-29-p-PA 549 CG8947-PA 242..546 27..333 388 32.6 Plus
CG12163-PB 475 CG12163-PB 170..468 37..330 308 28.9 Plus
CG12163-PA 614 CG12163-PA 309..607 37..330 308 28.9 Plus
CG6337-PB 340 CG6337-PB 27..326 29..322 238 27.8 Plus
CG6337-PA 340 CG6337-PA 27..326 29..322 238 27.8 Plus
Swim-PA 431 CG3074-PA 200..411 129..327 238 30.6 Plus
Swim-PB 431 CG3074-PB 200..411 129..327 238 30.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21205-PA 339 GI21205-PA 1..337 6..334 619 38 Plus
Dmoj\GI20850-PA 329 GI20850-PA 3..327 7..334 465 33.8 Plus
Dmoj\GI13676-PA 324 GI13676-PA 3..322 7..334 462 34.7 Plus
Dmoj\GI18640-PA 243 GI18640-PA 16..243 113..336 433 37.8 Plus
Dmoj\GI11629-PA 253 GI11629-PA 1..253 75..336 398 34.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24978-PA 338 GL24978-PA 1..336 1..334 1001 58.3 Plus
Dper\GL17172-PA 341 GL17172-PA 2..339 5..334 611 38.1 Plus
Dper\GL17477-PA 353 GL17477-PA 9..353 6..336 476 33.1 Plus
Dper\GL15686-PA 323 GL15686-PA 7..321 12..334 446 33.5 Plus
Dper\GL11434-PA 372 GL11434-PA 84..370 48..334 430 34.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23577-PA 338 GA23577-PA 1..336 1..334 1003 58.3 Plus
Dpse\GA25021-PA 341 GA25021-PA 2..339 5..334 611 38.1 Plus
Dpse\GA25021-PB 319 GA25021-PB 11..317 32..334 591 39.7 Plus
Dpse\GA24205-PA 353 GA24205-PA 9..353 6..336 476 33.1 Plus
Dpse\GA23505-PA 323 GA23505-PA 7..321 12..334 461 34.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10576-PA 336 GM10576-PA 1..336 1..336 1602 91.4 Plus
Dsec\GM10853-PA 336 GM10853-PA 6..334 6..334 1335 73.9 Plus
Dsec\GM21500-PA 341 GM21500-PA 28..339 29..334 600 39 Plus
Dsec\GM21493-PA 352 GM21493-PA 9..352 6..336 492 33.2 Plus
Dsec\GM21790-PA 382 GM21790-PA 91..381 49..335 446 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19566-PA 336 GD19566-PA 1..336 1..336 1621 92.6 Plus
Dsim\GD19835-PA 336 GD19835-PA 6..334 6..334 1334 73.9 Plus
Dsim\GD10995-PA 341 GD10995-PA 28..339 29..334 597 38.7 Plus
Dsim\GD10987-PA 352 GD10987-PA 9..352 6..336 492 33.2 Plus
Dsim\GD11280-PA 382 GD11280-PA 91..380 49..334 437 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20806-PA 339 GJ20806-PA 1..337 6..334 608 38 Plus
Dvir\GJ13554-PA 331 GJ13554-PA 3..329 7..334 530 37.5 Plus
Dvir\GJ20585-PA 333 GJ20585-PA 3..331 7..334 507 35.5 Plus
Dvir\GJ14012-PA 327 GJ14012-PA 1..326 9..334 494 34.1 Plus
Dvir\GJ21653-PA 342 GJ21653-PA 30..342 29..336 492 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19626-PA 341 GK19626-PA 4..339 11..334 579 36.7 Plus
Dwil\GK17860-PA 341 GK17860-PA 36..336 30..321 440 33.3 Plus
Dwil\GK22909-PA 370 GK22909-PA 55..368 24..334 412 32.2 Plus
Dwil\GK22908-PA 381 GK22908-PA 94..379 48..334 398 34.2 Plus
Dwil\GK16790-PA 549 GK16790-PA 236..546 21..333 386 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24121-PA 338 GE24121-PA 1..338 1..336 1478 83.4 Plus
Dyak\GE10178-PA 336 GE10178-PA 1..334 1..334 1278 70.7 Plus
Dyak\GE12574-PA 341 GE12574-PA 28..339 29..334 600 38.9 Plus
Dyak\GE12565-PA 353 GE12565-PA 9..353 6..336 498 34 Plus
Dyak\GE26053-PA 338 GE26053-PA 34..335 28..333 437 32.5 Plus