Clone GH15296 Report

Search the DGRC for GH15296

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:152
Well:96
Vector:pOT2
Associated Gene/TranscriptScp1-RA
Protein status:GH15296.pep: gold
Preliminary Size:1122
Sequenced Size:1009

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15848 2002-01-01 Sim4 clustering to Release 2
CG15848 2002-05-15 Blastp of sequenced clone
CG15848 2003-01-01 Sim4 clustering to Release 3
Scp1 2008-04-29 Release 5.5 accounting
Scp1 2008-08-15 Release 5.9 accounting
Scp1 2008-12-18 5.12 accounting

Clone Sequence Records

GH15296.complete Sequence

1009 bp (1009 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118788

> GH15296.complete
CCGAAGCTATTTACATTTTATGAGGATAAGCTCCAAACAAATTCCGTCAT
AATGGCTTATTCCTGGGATAACCGTGTCGATTTTGTCGTTCGGTATATGT
ATGATATCGACAACAATGGATTTCTGGACCAAAATGATTTTCTGTGCATG
GCAGTAAGAGCATGTGTCGTAGAAGGAAAAGGTGATTGCAGCACTGCTCG
ATTGGATGATTATAAAAAGCTAATGAAAAATTTATGGGATGAAATCTCTG
CTATTGCTGACGACGATAAGGATGGCAAAATATCCAATCAAGAATTTAAG
GATGCTGTAAAAAAAACATGTGTGGGTAAAAAGTACGAAGAATTTCCACA
GGCAATGAGAGCATTCATTGAATCAAACTTCAAGCTTCTTGACATAGACA
GCGATGGAATAGTCGGAGTTAAAGAATACCGTTATAACTGTATAACTAGA
GTAGCCATCGACGATATTACTCCAATTGATAAAGCCTTTGAAACATTGTT
GAATGACGAGGACCGGAAACGTGGCGGTCTTTCCCTAGATCGCTATAAGG
AACTGTATGGTCAATTTTTGGGAAACACAGCCGATAATCATCCAGCAGTA
AATCTCTTTGGGCCCTTATAAACATATTTTACAATTAATTGTCTTCGCTG
TTGTTCAACAACTATTTATTAAGTTTTATTTGTAATTACTATGACTTTAA
ATTTATTACCGTATAGAAATAATACATTCATATCATTTTGTGTAGAATCG
TCAGATGAGTTCGTCAGTTCGTTATTTTTAATGCTTTATAATACGTTAAG
TACAATTGCTCTCAGAAGATAATAATAGGATATAGAGTTGGCGTTCTCTC
TTAAAAGGGCTCTTCTGTTAAAACCTCTCTCTCAATACAGAGTTGATTTC
GATTAAATGTTGTGTTATATTAATGTTACCATAATGTAAACTATTTAATA
AAATGCCTAAACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

GH15296.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Scp1-RA 1066 Scp1-RA 105..1066 1..962 4810 100 Plus
Scp1.a 1198 Scp1.a 69..1029 6..966 4805 100 Plus
Scp1.b 1198 Scp1.b 70..1029 7..966 4800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2RHet 3288813 chr2RHet 1707872..1708329 962..505 2290 100 Minus
chr2RHet 3288813 chr2RHet 1738099..1738267 271..103 845 100 Minus
chr2RHet 3288813 chr2RHet 1712715..1712870 505..350 780 100 Minus
chr2RHet 3288813 chr2RHet 1631041..1631196 505..350 750 98.7 Minus
chr2RHet 3288813 chr2RHet 1628322..1628454 506..374 620 97.7 Minus
chr2RHet 3288813 chr2RHet 1742139..1742237 103..5 495 100 Minus
chr2RHet 3288813 chr2RHet 1730040..1730123 352..269 420 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:53:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 2932823..2933284 966..505 2310 100 Minus
2R 25286936 2R 2963055..2963223 271..103 845 100 Minus
2R 25286936 2R 2937670..2937825 505..350 780 100 Minus
2R 25286936 2R 2856001..2856156 505..350 750 98.7 Minus
2R 25286936 2R 2853283..2853415 506..374 620 97.7 Minus
2R 25286936 2R 2967095..2967193 103..5 495 100 Minus
2R 25286936 2R 2954996..2955079 352..269 420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 2932823..2933284 966..505 2310 100 Minus
2R 25260384 2R 2963055..2963223 271..103 845 100 Minus
2R 25260384 2R 2937670..2937825 505..350 780 100 Minus
2R 25260384 2R 2856001..2856156 505..350 750 98.7 Minus
2R 25260384 2R 2853283..2853415 506..374 620 97.7 Minus
2R 25260384 2R 2967095..2967193 103..5 495 100 Minus
2R 25260384 2R 2954996..2955079 352..269 420 100 Minus
Blast to na_te.dros performed 2019-03-15 12:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 2636..2717 741..660 139 66.3 Minus

GH15296.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:02:11 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
chr2RHet 1707872..1708329 505..962 100 <- Minus
chr2RHet 1712716..1712868 352..504 100 <- Minus
chr2RHet 1730041..1730121 271..351 100 <- Minus
chr2RHet 1738100..1738255 115..270 100 <- Minus
chr2RHet 1742126..1742237 1..114 91   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:52:21 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 1..570 52..621 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:51 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 1..570 52..621 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:36:03 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 1..570 52..621 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:28 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 1..570 52..621 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:48:57 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 1..570 52..621 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:52:21 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 23..984 1..962 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:51 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 23..984 1..962 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:36:03 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 23..984 1..962 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:28 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 23..984 1..962 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:48:57 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
Scp1-RA 23..984 1..962 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:11 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 2954997..2955077 271..351 100 <- Minus
2R 2963056..2963222 104..270 100 <- Minus
2R 2967095..2967193 1..103 96   Minus
2R 2932827..2933284 505..962 100 <- Minus
2R 2937671..2937823 352..504 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:11 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 2954997..2955077 271..351 100 <- Minus
2R 2963056..2963222 104..270 100 <- Minus
2R 2967095..2967193 1..103 96   Minus
2R 2932827..2933284 505..962 100 <- Minus
2R 2937671..2937823 352..504 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:11 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 2954997..2955077 271..351 100 <- Minus
2R 2963056..2963222 104..270 100 <- Minus
2R 2967095..2967193 1..103 96   Minus
2R 2932827..2933284 505..962 100 <- Minus
2R 2937671..2937823 352..504 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:36:03 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
2RHet 1712640..1712792 352..504 100 <- Minus
2RHet 1729966..1730046 271..351 100 <- Minus
2RHet 1738025..1738191 104..270 100 <- Minus
2RHet 1742064..1742162 1..103 96   Minus
2RHet 1707796..1708253 505..962 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:49 Download gff for GH15296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 2932827..2933284 505..962 100 <- Minus
2R 2937671..2937823 352..504 100 <- Minus
2R 2954997..2955077 271..351 100 <- Minus
2R 2963056..2963222 104..270 100 <- Minus
2R 2967095..2967193 1..103 96   Minus

GH15296.hyp Sequence

Translation from 6 to 620

> GH15296.hyp
LFTFYEDKLQTNSVIMAYSWDNRVDFVVRYMYDIDNNGFLDQNDFLCMAV
RACVVEGKGDCSTARLDDYKKLMKNLWDEISAIADDDKDGKISNQEFKDA
VKKTCVGKKYEEFPQAMRAFIESNFKLLDIDSDGIVGVKEYRYNCITRVA
IDDITPIDKAFETLLNDEDRKRGGLSLDRYKELYGQFLGNTADNHPAVNL
FGPL*

GH15296.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Scp1-PB 189 CG15848-PB 1..189 16..204 1007 100 Plus
Scp1-PA 189 CG15848-PA 1..189 16..204 1007 100 Plus

GH15296.pep Sequence

Translation from 51 to 620

> GH15296.pep
MAYSWDNRVDFVVRYMYDIDNNGFLDQNDFLCMAVRACVVEGKGDCSTAR
LDDYKKLMKNLWDEISAIADDDKDGKISNQEFKDAVKKTCVGKKYEEFPQ
AMRAFIESNFKLLDIDSDGIVGVKEYRYNCITRVAIDDITPIDKAFETLL
NDEDRKRGGLSLDRYKELYGQFLGNTADNHPAVNLFGPL*

GH15296.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14448-PA 291 GF14448-PA 121..291 19..189 895 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23100-PA 189 GG23100-PA 1..189 1..189 988 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13373-PA 189 GH13373-PA 1..189 1..189 945 92.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Scp1-PB 189 CG15848-PB 1..189 1..189 1007 100 Plus
Scp1-PA 189 CG15848-PA 1..189 1..189 1007 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18277-PA 226 GI18277-PA 109..226 72..189 592 92.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24797-PA 130 GL24797-PA 1..124 1..124 636 97.6 Plus
Dper\GL25464-PA 65 GL25464-PA 1..50 102..151 254 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17530-PA 757 GJ17530-PA 641..757 73..189 588 91.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21213-PA 104 GK21213-PA 15..104 100..189 458 95.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Scp1-PA 189 GE22673-PA 1..189 1..189 988 98.9 Plus