Clone GH15428 Report

Search the DGRC for GH15428

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:154
Well:28
Vector:pOT2
Associated Gene/TranscriptCG31706-RA
Protein status:GH15428.pep: gold
Preliminary Size:1252
Sequenced Size:1135

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6528 2001-01-01 Release 2 assignment
CG31706 2003-01-01 Sim4 clustering to Release 3
CG31706 2003-02-27 Blastp of sequenced clone
CG31706 2008-04-29 Release 5.5 accounting
CG31706 2008-08-15 Release 5.9 accounting
CG31706 2008-12-18 5.12 accounting

Clone Sequence Records

GH15428.complete Sequence

1135 bp (1135 high quality bases) assembled on 2003-02-27

GenBank Submission: AY069141

> GH15428.complete
ATCAGTTGAGATCATTTGAAAACTATCGCATCCAAGATGAAATCCTGGTA
CCTAGCACTCAGCCTGCTGCTCCTCGCCGCATCCACAATTCAGCCCACTG
ACGCTCGTGGCGGAAGGGGGCGTGGCGGCGGCTCATTTGGCGGACTCTTT
GGCGGTTGGCGCAAGTACAAGAAGCCCTCGTCGTCGGGCGGTGGTCGGCG
GGTGGTGAGCGGTTCGCCAGTTCACACGGCCATGACGGTGCCGAAACCAC
CACCGCCTCCGCCGGCACCACCAAAGATGCCCATGATGCCGCCCAAGCAG
CAAATCCCCAGCTATCCTCGCCAGCAGATGCCACCTGGCTATGGCTTTGG
ATCGTATCCGGGCCAAGGCAGTGGAACGTACTACGCCAATGCCCAGGCCC
TGCCAGCGGGAGCGGTTTACTATGCCCAACCACCCGTCGGAATGAATCGA
GGAATCGGTACAGGAGATTTCCTCACCGGAATGCTGGCGGGTCACATGAT
GAACAACGTTCTGTTTGGCCACCGACACCATACGTACCATAGAAATCCGG
AGGAGGGCCAGTCGTCGCCCCAGGGAAATGGTCGACAGATCATCATCGTC
AACAATGGTCAGCAGGAGGGAGTTTTGCACAATGAGACCACTATTTCAGG
AGAATCCTCCGCAGTGGTCCCCCCGGAAAATCCCCTAACGGAGGAGGATG
ACGTAGAGGGGCAGGGCGAAGGTGACGGAGGAAGTGAAGCTGTTTCCAGT
GAGGAATCCACGGAATCGGAGGCAACTCCTCAGCCCTATCCAGATGGTGG
CATCATTTGCTTTCCCATCATGCTAAACGAAACAGATCCCGAAAACTCGG
AGGTGATGCGAGAAGTGGAACGGGTCGTTTGCTTTCCAGCTCCACCCCAC
AATCCGGGCAATTTCCAACCCACCATAACCACTGAGCCACCCATCGTTGC
CGGCGATATTGTTGGTCGTGCAGATGATGGTACAGAAGTTGGTGGTGGTG
ATGAGGTCAGCCATGCAGGTACTCCCGTGGATGTGGCCAACTTTGTAGCT
GCAAGAAATGATGAAGTCGAAACGGATTCTACTAAAAACTAAGTTAAATA
AAGCGAACTAAAGATTTAAAAAAAAAAAAAAAAAA

GH15428.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31706-RA 1332 CG31706-RA 115..1234 1..1120 5600 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11528273..11528933 1117..457 3305 100 Minus
chr2L 23010047 chr2L 11529321..11529779 459..1 2235 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:54:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11529521..11530184 1120..457 3320 100 Minus
2L 23513712 2L 11530572..11531030 459..1 2295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11529521..11530184 1120..457 3320 100 Minus
2L 23513712 2L 11530572..11531030 459..1 2295 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:37:51 has no hits.

GH15428.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:38:39 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11528273..11528932 458..1117 100 <- Minus
chr2L 11529323..11529779 1..457 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:44:30 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 1..1056 37..1092 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:52 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 1..1056 37..1092 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:55 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 1..1056 37..1092 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:39:15 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 1..1056 37..1092 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:38:51 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 1..1056 37..1092 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:56 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 20..1136 1..1117 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:52 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 20..1136 1..1117 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:55 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 23..1139 1..1117 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:39:15 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 20..1136 1..1117 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:38:51 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
CG31706-RA 23..1139 1..1117 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:39 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11529524..11530183 458..1117 100 <- Minus
2L 11530574..11531030 1..457 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:39 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11529524..11530183 458..1117 100 <- Minus
2L 11530574..11531030 1..457 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:38:39 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11529524..11530183 458..1117 100 <- Minus
2L 11530574..11531030 1..457 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:55 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11529524..11530183 458..1117 100 <- Minus
arm_2L 11530574..11531030 1..457 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:35 Download gff for GH15428.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11529524..11530183 458..1117 100 <- Minus
2L 11530574..11531030 1..457 100   Minus

GH15428.hyp Sequence

Translation from 36 to 1091

> GH15428.hyp
MKSWYLALSLLLLAASTIQPTDARGGRGRGGGSFGGLFGGWRKYKKPSSS
GGGRRVVSGSPVHTAMTVPKPPPPPPAPPKMPMMPPKQQIPSYPRQQMPP
GYGFGSYPGQGSGTYYANAQALPAGAVYYAQPPVGMNRGIGTGDFLTGML
AGHMMNNVLFGHRHHTYHRNPEEGQSSPQGNGRQIIIVNNGQQEGVLHNE
TTISGESSAVVPPENPLTEEDDVEGQGEGDGGSEAVSSEESTESEATPQP
YPDGGIICFPIMLNETDPENSEVMREVERVVCFPAPPHNPGNFQPTITTE
PPIVAGDIVGRADDGTEVGGGDEVSHAGTPVDVANFVAARNDEVETDSTK
N*

GH15428.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:00:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31706-PB 351 CG31706-PB 1..351 1..351 1895 100 Plus
CG31706-PA 351 CG31706-PA 1..351 1..351 1895 100 Plus
CG5273-PB 469 CG5273-PB 153..392 58..287 250 32.4 Plus
CG5273-PC 469 CG5273-PC 153..392 58..287 250 32.4 Plus
CG5273-PA 469 CG5273-PA 153..392 58..287 250 32.4 Plus

GH15428.pep Sequence

Translation from 36 to 1091

> GH15428.pep
MKSWYLALSLLLLAASTIQPTDARGGRGRGGGSFGGLFGGWRKYKKPSSS
GGGRRVVSGSPVHTAMTVPKPPPPPPAPPKMPMMPPKQQIPSYPRQQMPP
GYGFGSYPGQGSGTYYANAQALPAGAVYYAQPPVGMNRGIGTGDFLTGML
AGHMMNNVLFGHRHHTYHRNPEEGQSSPQGNGRQIIIVNNGQQEGVLHNE
TTISGESSAVVPPENPLTEEDDVEGQGEGDGGSEAVSSEESTESEATPQP
YPDGGIICFPIMLNETDPENSEVMREVERVVCFPAPPHNPGNFQPTITTE
PPIVAGDIVGRADDGTEVGGGDEVSHAGTPVDVANFVAARNDEVETDSTK
N*

GH15428.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15340-PA 363 GF15340-PA 1..359 1..345 851 64.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13083-PA 418 GG13083-PA 142..418 60..336 1121 85.6 Plus
Dere\GG13083-PA 418 GG13083-PA 1..140 1..140 380 92.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10373-PA 350 GH10373-PA 63..330 61..313 487 52 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31706-PB 351 CG31706-PB 1..351 1..351 1895 100 Plus
CG31706-PA 351 CG31706-PA 1..351 1..351 1895 100 Plus
CG5273-PB 469 CG5273-PB 153..392 58..287 250 32.4 Plus
CG5273-PC 469 CG5273-PC 153..392 58..287 250 32.4 Plus
CG5273-PA 469 CG5273-PA 153..392 58..287 250 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21387-PA 337 GI21387-PA 112..282 113..290 422 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18818-PA 345 GL18818-PA 1..343 1..348 830 62.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16410-PA 345 GA16410-PA 1..343 1..348 842 63.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11045-PA 321 GM11045-PA 1..320 1..348 1584 90.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22166-PA 269 GD22166-PA 1..268 81..348 1369 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11183-PA 335 GJ11183-PA 63..334 61..335 518 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24675-PA 343 GK24675-PA 43..335 40..340 599 54.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12796-PA 348 GE12796-PA 1..347 1..348 1164 83.7 Plus