Clone GH15688 Report

Search the DGRC for GH15688

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:156
Well:88
Vector:pOT2
Associated Gene/TranscriptCoVIII-RA
Protein status:GH15688.pep: gold
Preliminary Size:409
Sequenced Size:433

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7181 2002-01-01 Sim4 clustering to Release 2
CG7181 2002-05-18 Blastp of sequenced clone
CG7181 2003-01-01 Sim4 clustering to Release 3
CG7181 2008-04-29 Release 5.5 accounting
CG7181 2008-08-15 Release 5.9 accounting
CG7181 2008-12-18 5.12 accounting

Clone Sequence Records

GH15688.complete Sequence

433 bp (433 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118790

> GH15688.complete
AAAGAAAGGCGAATGACAAATCGTTAAGAAGAAGCATTCTAACCTTACAG
CATTGATTTTACGCCAGCGTATTTTGCGAAAAAGTTTGTGAAAATGTTCC
AAAACAGCGCTGCCCGCCTCCTGGTCCCCGCTATGCGTAGCGCCATGCAG
AGCCGTTGCCAGTCGGTCGTCTCTGGACCTCCGACCCAGCGCATCTCCAC
CGCCGAGAAGGTGATCCTCGGCGGCGGCATGTGCGCTGCATCCTTGTTCA
TTCCCGCCTGGGTGCTCTACCACATCCGGGACTACAAGGGCGACAAGTAA
TCTGCATACGAGACCACACATAGTTAATACGCTTGTAAAGTAGAGAGCAT
CAATATATCAATAGTGCCCCTGTTACGGGGAAATAAACTATAGTGCATTG
AGCCACAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH15688.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG7181-RA 628 CG7181-RA 116..524 1..409 2045 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21528178..21528382 205..1 1025 100 Minus
chr3L 24539361 chr3L 21527901..21528102 406..205 1010 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:54:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21538963..21539167 409..205 1025 100 Minus
3L 28110227 3L 21539243..21539447 205..1 1025 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21532343..21532547 205..1 1025 100 Minus
3L 28103327 3L 21532063..21532267 409..205 1025 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:20:40 has no hits.

GH15688.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:21:29 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21527901..21528102 205..406 100 <- Minus
chr3L 21528179..21528382 1..204 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:44:53 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 1..207 94..300 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:44 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 1..207 94..300 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:49:42 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 1..207 94..300 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:09 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 1..207 94..300 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:07:44 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 1..207 94..300 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:40 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:44 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:49:42 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:09 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CG7181-RA 1..406 1..406 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:07:44 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
CoVIII-RB 1..406 1..406 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:29 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21538966..21539167 205..406 100 <- Minus
3L 21539244..21539447 1..204 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:29 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21538966..21539167 205..406 100 <- Minus
3L 21539244..21539447 1..204 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:29 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21538966..21539167 205..406 100 <- Minus
3L 21539244..21539447 1..204 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:49:42 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21532066..21532267 205..406 100 <- Minus
arm_3L 21532344..21532547 1..204 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:16 Download gff for GH15688.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21532344..21532547 1..204 100   Minus
3L 21532066..21532267 205..406 100 <- Minus

GH15688.hyp Sequence

Translation from 93 to 299

> GH15688.hyp
MFQNSAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAAS
LFIPAWVLYHIRDYKGDK*

GH15688.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
CoVIII-PA 68 CG7181-PA 1..68 1..68 350 100 Plus
CoVIII-PB 68 CG7181-PB 1..68 1..68 350 100 Plus

GH15688.pep Sequence

Translation from 93 to 299

> GH15688.pep
MFQNSAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAAS
LFIPAWVLYHIRDYKGDK*

GH15688.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10704-PA 68 GF10704-PA 1..68 1..68 343 94.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13224-PA 68 GG13224-PA 1..68 1..68 345 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14788-PA 68 GH14788-PA 1..68 1..68 288 76.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
COX8-PA 68 CG7181-PA 1..68 1..68 350 100 Plus
COX8-PB 68 CG7181-PB 1..68 1..68 350 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11842-PA 68 GI11842-PA 1..68 1..68 310 83.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11901-PA 68 GL11901-PA 1..68 1..68 327 89.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20161-PA 68 GA20161-PA 1..68 1..68 321 88.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22130-PA 68 GM22130-PA 1..68 1..68 359 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CoVIII-PA 68 GD12109-PA 1..68 1..68 359 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13541-PA 68 GJ13541-PA 1..68 1..68 330 91.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20371-PA 68 GK20371-PA 1..68 1..68 342 92.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22321-PA 68 GE22321-PA 1..68 1..68 345 95.6 Plus
Dyak\GE22319-PA 68 GE22319-PA 1..68 1..68 345 95.6 Plus