BDGP Sequence Production Resources |
Search the DGRC for GH15688
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 156 |
Well: | 88 |
Vector: | pOT2 |
Associated Gene/Transcript | CoVIII-RA |
Protein status: | GH15688.pep: gold |
Preliminary Size: | 409 |
Sequenced Size: | 433 |
Gene | Date | Evidence |
---|---|---|
CG7181 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7181 | 2002-05-18 | Blastp of sequenced clone |
CG7181 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7181 | 2008-04-29 | Release 5.5 accounting |
CG7181 | 2008-08-15 | Release 5.9 accounting |
CG7181 | 2008-12-18 | 5.12 accounting |
433 bp (433 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118790
> GH15688.complete AAAGAAAGGCGAATGACAAATCGTTAAGAAGAAGCATTCTAACCTTACAG CATTGATTTTACGCCAGCGTATTTTGCGAAAAAGTTTGTGAAAATGTTCC AAAACAGCGCTGCCCGCCTCCTGGTCCCCGCTATGCGTAGCGCCATGCAG AGCCGTTGCCAGTCGGTCGTCTCTGGACCTCCGACCCAGCGCATCTCCAC CGCCGAGAAGGTGATCCTCGGCGGCGGCATGTGCGCTGCATCCTTGTTCA TTCCCGCCTGGGTGCTCTACCACATCCGGGACTACAAGGGCGACAAGTAA TCTGCATACGAGACCACACATAGTTAATACGCTTGTAAAGTAGAGAGCAT CAATATATCAATAGTGCCCCTGTTACGGGGAAATAAACTATAGTGCATTG AGCCACAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7181-RA | 628 | CG7181-RA | 116..524 | 1..409 | 2045 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 21527901..21528102 | 205..406 | 100 | <- | Minus |
chr3L | 21528179..21528382 | 1..204 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7181-RA | 1..207 | 94..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7181-RA | 1..207 | 94..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIII-RB | 1..207 | 94..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7181-RA | 1..207 | 94..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIII-RB | 1..207 | 94..300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7181-RA | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7181-RA | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIII-RB | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7181-RA | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CoVIII-RB | 1..406 | 1..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21538966..21539167 | 205..406 | 100 | <- | Minus |
3L | 21539244..21539447 | 1..204 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21538966..21539167 | 205..406 | 100 | <- | Minus |
3L | 21539244..21539447 | 1..204 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21538966..21539167 | 205..406 | 100 | <- | Minus |
3L | 21539244..21539447 | 1..204 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 21532066..21532267 | 205..406 | 100 | <- | Minus |
arm_3L | 21532344..21532547 | 1..204 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 21532344..21532547 | 1..204 | 100 | Minus | |
3L | 21532066..21532267 | 205..406 | 100 | <- | Minus |
Translation from 93 to 299
> GH15688.hyp MFQNSAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAAS LFIPAWVLYHIRDYKGDK*
Translation from 93 to 299
> GH15688.pep MFQNSAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAAS LFIPAWVLYHIRDYKGDK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10704-PA | 68 | GF10704-PA | 1..68 | 1..68 | 343 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13224-PA | 68 | GG13224-PA | 1..68 | 1..68 | 345 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14788-PA | 68 | GH14788-PA | 1..68 | 1..68 | 288 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
COX8-PA | 68 | CG7181-PA | 1..68 | 1..68 | 350 | 100 | Plus |
COX8-PB | 68 | CG7181-PB | 1..68 | 1..68 | 350 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11842-PA | 68 | GI11842-PA | 1..68 | 1..68 | 310 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11901-PA | 68 | GL11901-PA | 1..68 | 1..68 | 327 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20161-PA | 68 | GA20161-PA | 1..68 | 1..68 | 321 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22130-PA | 68 | GM22130-PA | 1..68 | 1..68 | 359 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\CoVIII-PA | 68 | GD12109-PA | 1..68 | 1..68 | 359 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13541-PA | 68 | GJ13541-PA | 1..68 | 1..68 | 330 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20371-PA | 68 | GK20371-PA | 1..68 | 1..68 | 342 | 92.6 | Plus |