BDGP Sequence Production Resources |
Search the DGRC for GH15938
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 159 |
Well: | 38 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpL33-RA |
Protein status: | GH15938.pep: gold |
Preliminary Size: | 318 |
Sequenced Size: | 348 |
Gene | Date | Evidence |
---|---|---|
CG3712 | 2002-01-01 | Sim4 clustering to Release 2 |
CG3712 | 2002-05-18 | Blastp of sequenced clone |
CG3712 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL33 | 2008-04-29 | Release 5.5 accounting |
mRpL33 | 2008-08-15 | Release 5.9 accounting |
mRpL33 | 2008-12-18 | 5.12 accounting |
348 bp (348 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118791
> GH15938.complete CTTGCTTGCACAATAATTTCAGCGGCATATTTCCATAATTCACTGCATTT TCCCCATTTACCGAATCAAAATGCGTCTAACTAACGTTTTGTTCAAAAAG GTGAAGAGCAAGCGCATCATGGTCGTACTGGAAAGTGTGGTCAGTGGACA TCAGTTTAATGCTTTTCGCGATCGCTTGGCCGACAAATTGGAGATAATAC GCTTCGATCCGTACATTCAACAGGAAAGCCTTTATCGTGAACGCAAGAAA ATCCGCAGCGCCTAAGATAACCATTTTTTGTTAGTGAAAAAAATAAAATT TACAACTATTGGAAACACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL33-RA | 488 | mRpL33-RA | 155..479 | 1..325 | 1625 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 4215166..4215277 | 112..1 | 560 | 100 | Minus |
chrX | 22417052 | chrX | 4214840..4214943 | 319..216 | 520 | 100 | Minus |
chrX | 22417052 | chrX | 4215007..4215110 | 215..112 | 520 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 4214840..4214943 | 216..319 | 100 | <- | Minus |
chrX | 4215007..4215110 | 112..215 | 100 | <- | Minus |
chrX | 4215167..4215277 | 1..111 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..195 | 71..265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..195 | 71..265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..195 | 71..265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..195 | 71..265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..195 | 71..265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..319 | 1..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..319 | 1..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 31..349 | 1..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 1..319 | 1..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL33-RA | 31..349 | 1..319 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4321764..4321867 | 216..319 | 100 | <- | Minus |
X | 4321931..4322034 | 112..215 | 100 | <- | Minus |
X | 4322091..4322201 | 1..111 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4321764..4321867 | 216..319 | 100 | <- | Minus |
X | 4321931..4322034 | 112..215 | 100 | <- | Minus |
X | 4322091..4322201 | 1..111 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4321764..4321867 | 216..319 | 100 | <- | Minus |
X | 4321931..4322034 | 112..215 | 100 | <- | Minus |
X | 4322091..4322201 | 1..111 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 4215797..4215900 | 216..319 | 100 | <- | Minus |
arm_X | 4215964..4216067 | 112..215 | 100 | <- | Minus |
arm_X | 4216124..4216234 | 1..111 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4329862..4329965 | 216..319 | 100 | <- | Minus |
X | 4330029..4330132 | 112..215 | 100 | <- | Minus |
X | 4330189..4330299 | 1..111 | 100 | Minus |
Translation from 70 to 264
> GH15938.hyp MRLTNVLFKKVKSKRIMVVLESVVSGHQFNAFRDRLADKLEIIRFDPYIQ QESLYRERKKIRSA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL33-PA | 64 | CG3712-PA | 1..64 | 1..64 | 314 | 100 | Plus |
Translation from 70 to 264
> GH15938.pep MRLTNVLFKKVKSKRIMVVLESVVSGHQFNAFRDRLADKLEIIRFDPYIQ QESLYRERKKIRSA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21473-PA | 64 | GF21473-PA | 1..64 | 1..64 | 316 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18546-PA | 64 | GG18546-PA | 1..64 | 1..64 | 321 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24666-PA | 64 | GH24666-PA | 1..64 | 1..64 | 302 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL33-PA | 64 | CG3712-PA | 1..64 | 1..64 | 314 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16131-PA | 64 | GI16131-PA | 1..64 | 1..64 | 290 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13064-PA | 64 | GL13064-PA | 1..64 | 1..64 | 301 | 89.1 | Plus |
Dper\GL13063-PA | 64 | GL13063-PA | 1..64 | 1..64 | 301 | 89.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27868-PA | 64 | GA27868-PA | 1..64 | 1..64 | 301 | 89.1 | Plus |
Dpse\GA27867-PA | 64 | GA27867-PA | 1..64 | 1..64 | 301 | 89.1 | Plus |
Dpse\GA17634-PA | 64 | GA17634-PA | 1..64 | 1..64 | 301 | 89.1 | Plus |
Dpse\GA23212-PA | 56 | GA23212-PA | 1..48 | 1..48 | 231 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12691-PA | 64 | GM12691-PA | 1..64 | 1..64 | 321 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16299-PA | 64 | GD16299-PA | 1..64 | 1..64 | 321 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16409-PA | 64 | GJ16409-PA | 1..64 | 1..64 | 312 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10505-PA | 64 | GK10505-PA | 1..64 | 1..64 | 311 | 93.8 | Plus |
Dwil\GK17489-PA | 64 | GK17489-PA | 1..64 | 1..64 | 311 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16861-PA | 64 | GE16861-PA | 1..64 | 1..64 | 317 | 96.9 | Plus |