Clone GH15938 Report

Search the DGRC for GH15938

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:159
Well:38
Vector:pOT2
Associated Gene/TranscriptmRpL33-RA
Protein status:GH15938.pep: gold
Preliminary Size:318
Sequenced Size:348

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3712 2002-01-01 Sim4 clustering to Release 2
CG3712 2002-05-18 Blastp of sequenced clone
CG3712 2003-01-01 Sim4 clustering to Release 3
mRpL33 2008-04-29 Release 5.5 accounting
mRpL33 2008-08-15 Release 5.9 accounting
mRpL33 2008-12-18 5.12 accounting

Clone Sequence Records

GH15938.complete Sequence

348 bp (348 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118791

> GH15938.complete
CTTGCTTGCACAATAATTTCAGCGGCATATTTCCATAATTCACTGCATTT
TCCCCATTTACCGAATCAAAATGCGTCTAACTAACGTTTTGTTCAAAAAG
GTGAAGAGCAAGCGCATCATGGTCGTACTGGAAAGTGTGGTCAGTGGACA
TCAGTTTAATGCTTTTCGCGATCGCTTGGCCGACAAATTGGAGATAATAC
GCTTCGATCCGTACATTCAACAGGAAAGCCTTTATCGTGAACGCAAGAAA
ATCCGCAGCGCCTAAGATAACCATTTTTTGTTAGTGAAAAAAATAAAATT
TACAACTATTGGAAACACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH15938.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 488 mRpL33-RA 155..479 1..325 1625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4215166..4215277 112..1 560 100 Minus
chrX 22417052 chrX 4214840..4214943 319..216 520 100 Minus
chrX 22417052 chrX 4215007..4215110 215..112 520 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:54:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4322090..4322201 112..1 560 100 Minus
X 23542271 X 4321758..4321867 325..216 550 100 Minus
X 23542271 X 4321931..4322034 215..112 520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4330188..4330299 112..1 560 100 Minus
X 23527363 X 4329856..4329965 325..216 550 100 Minus
X 23527363 X 4330029..4330132 215..112 520 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:33:44 has no hits.

GH15938.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:35:06 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4214840..4214943 216..319 100 <- Minus
chrX 4215007..4215110 112..215 100 <- Minus
chrX 4215167..4215277 1..111 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:45:19 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:22 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:39:15 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:38 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:40:25 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:00 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..319 1..319 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:22 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..319 1..319 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:39:15 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 31..349 1..319 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:39 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..319 1..319 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:40:25 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 31..349 1..319 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:06 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
X 4321764..4321867 216..319 100 <- Minus
X 4321931..4322034 112..215 100 <- Minus
X 4322091..4322201 1..111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:06 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
X 4321764..4321867 216..319 100 <- Minus
X 4321931..4322034 112..215 100 <- Minus
X 4322091..4322201 1..111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:06 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
X 4321764..4321867 216..319 100 <- Minus
X 4321931..4322034 112..215 100 <- Minus
X 4322091..4322201 1..111 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:39:15 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4215797..4215900 216..319 100 <- Minus
arm_X 4215964..4216067 112..215 100 <- Minus
arm_X 4216124..4216234 1..111 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:02 Download gff for GH15938.complete
Subject Subject Range Query Range Percent Splice Strand
X 4329862..4329965 216..319 100 <- Minus
X 4330029..4330132 112..215 100 <- Minus
X 4330189..4330299 1..111 100   Minus

GH15938.hyp Sequence

Translation from 70 to 264

> GH15938.hyp
MRLTNVLFKKVKSKRIMVVLESVVSGHQFNAFRDRLADKLEIIRFDPYIQ
QESLYRERKKIRSA*

GH15938.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-PA 64 CG3712-PA 1..64 1..64 314 100 Plus

GH15938.pep Sequence

Translation from 70 to 264

> GH15938.pep
MRLTNVLFKKVKSKRIMVVLESVVSGHQFNAFRDRLADKLEIIRFDPYIQ
QESLYRERKKIRSA*

GH15938.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21473-PA 64 GF21473-PA 1..64 1..64 316 96.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18546-PA 64 GG18546-PA 1..64 1..64 321 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24666-PA 64 GH24666-PA 1..64 1..64 302 90.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:58
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-PA 64 CG3712-PA 1..64 1..64 314 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16131-PA 64 GI16131-PA 1..64 1..64 290 85.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13064-PA 64 GL13064-PA 1..64 1..64 301 89.1 Plus
Dper\GL13063-PA 64 GL13063-PA 1..64 1..64 301 89.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27868-PA 64 GA27868-PA 1..64 1..64 301 89.1 Plus
Dpse\GA27867-PA 64 GA27867-PA 1..64 1..64 301 89.1 Plus
Dpse\GA17634-PA 64 GA17634-PA 1..64 1..64 301 89.1 Plus
Dpse\GA23212-PA 56 GA23212-PA 1..48 1..48 231 89.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12691-PA 64 GM12691-PA 1..64 1..64 321 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16299-PA 64 GD16299-PA 1..64 1..64 321 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16409-PA 64 GJ16409-PA 1..64 1..64 312 95.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10505-PA 64 GK10505-PA 1..64 1..64 311 93.8 Plus
Dwil\GK17489-PA 64 GK17489-PA 1..64 1..64 311 93.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16861-PA 64 GE16861-PA 1..64 1..64 317 96.9 Plus