BDGP Sequence Production Resources |
Search the DGRC for GH16072
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 160 |
Well: | 72 |
Vector: | pOT2 |
Associated Gene/Transcript | NC2beta-RA |
Protein status: | GH16072.pep: gold |
Preliminary Size: | 839 |
Sequenced Size: | 718 |
Gene | Date | Evidence |
---|---|---|
CG4185 | 2001-01-01 | Release 2 assignment |
CG4185 | 2001-10-10 | Blastp of sequenced clone |
CG4185 | 2003-01-01 | Sim4 clustering to Release 3 |
NC2beta | 2008-04-29 | Release 5.5 accounting |
NC2beta | 2008-08-15 | Release 5.9 accounting |
NC2beta | 2008-12-18 | 5.12 accounting |
718 bp assembled on 2006-11-09
GenBank Submission: AY060717
> GH16072.complete CACACTATACTAGTAAATCCGAGAAAAACATCTGCTTCCAAGTTTGTTTG TTTGTTTGTTCCTTGAAACCAGGACGCCATGTCGAATCCGCAGGAAGAAC TACTGCCGCCCAGCGCCGAGGACGACGAGCTGACCCTGCCACGGGCCAGC ATCAACAAGATCATCAAGGAGCTGGTGCCCACGGTGCGGGTGGCCAACGA GAGTCGCGAGCTGATACTCAACTGCTGCTCAGAGTTCATTCATCTGATCA GTTCGGAGGCCAACGAGGTGTGCAACATGCGCAACAAGAAGACGATAAAC GCAGAGCACGTCCTGGAGGCGTTGGAACGCTTGGGTTTTCACGACTACAA ACAAGAGGCGGAGGCCGTTCTGCACGACTGCAAGGAGGTGGCAGCCAAGC GAAGGCGCCAGAGCACGCGCCTAGAGAACCTGGGCATTCCGGAGGAGGAG CTGCTGCGCCAGCAGCAGGAGCTGTTCGCCAAGGCACGCGAGGAGCAGGC GCGCGAGGAGCAGCAGCAGTGGATGAGCATGCAAGCGGCAGCAATGGTGC AGCGACCACCGCTGGCAGACGGCTCCGTTGCCAGCAAGCCAAGTGAGGAT GACGATGACGATGACGACGACGACTACTAGTAGGAAATAGTCTTTCTATG AGCTTAGTGTAGATTTAATCTTAAAATATATGCCATAAGTTGAACTTTCA AAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 15006633..15007331 | 1..699 | 3465 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 15007840..15008540 | 1..701 | 3505 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 15007840..15008540 | 1..701 | 3505 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
G-element | 4346 | G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). | 375..611 | 401..635 | 153 | 56.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 15006633..15007331 | 1..699 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 1..552 | 79..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 1..552 | 79..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 1..552 | 79..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 1..552 | 79..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 1..552 | 79..630 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 22..720 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 35..733 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 28..726 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 22..720 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
NC2beta-RA | 28..726 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15007840..15008538 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15007840..15008538 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15007840..15008538 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 15007840..15008538 | 1..699 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 15007840..15008538 | 1..699 | 100 | Plus |
Translation from 2 to 595
> GH16072.hyp HYTSKSEKNICFQVCLFVCSLKPGRHVESAGRTTAAQRRGRRADPATGQH QQDHQGAGAHGAGGQRESRADTQLLLRVHSSDQFGGQRGVQHAQQEDDKR RARPGGVGTLGFSRLQTRGGGRSARLQGGGSQAKAPEHAPREPGHSGGGA AAPAAGAVRQGTRGAGARGAAAVDEHASGSNGAATTAGRRLRCQQAK*
Translation from 78 to 629
> GH16072.pep MSNPQEELLPPSAEDDELTLPRASINKIIKELVPTVRVANESRELILNCC SEFIHLISSEANEVCNMRNKKTINAEHVLEALERLGFHDYKQEAEAVLHD CKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAREEQQQWMS MQAAAMVQRPPLADGSVASKPSEDDDDDDDDDY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14900-PA | 183 | GF14900-PA | 1..172 | 1..172 | 802 | 96.5 | Plus |
Dana\GF14901-PA | 77 | GF14901-PA | 4..77 | 110..183 | 238 | 94.6 | Plus |
Dana\GF14431-PA | 150 | GF14431-PA | 38..122 | 20..103 | 146 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25136-PA | 183 | GG25136-PA | 1..183 | 1..183 | 941 | 98.4 | Plus |
Dere\GG21205-PA | 156 | GG21205-PA | 43..127 | 20..103 | 146 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10911-PA | 198 | GH10911-PA | 1..198 | 1..183 | 707 | 84.8 | Plus |
Dgri\GH13827-PA | 153 | GH13827-PA | 44..128 | 20..103 | 145 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
NC2beta-PA | 183 | CG4185-PA | 1..183 | 1..183 | 935 | 100 | Plus |
Nf-YB-PB | 156 | CG10447-PB | 43..127 | 20..103 | 142 | 41.2 | Plus |
Nf-YB-PA | 156 | CG10447-PA | 43..127 | 20..103 | 142 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13215-PA | 203 | GI13215-PA | 1..203 | 1..183 | 727 | 83.7 | Plus |
Dmoj\GI20193-PA | 154 | GI20193-PA | 44..128 | 20..103 | 145 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26021-PA | 183 | GL26021-PA | 1..183 | 1..183 | 930 | 96.7 | Plus |
Dper\GL26173-PA | 156 | GL26173-PA | 43..127 | 20..103 | 146 | 40 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18013-PA | 183 | GA18013-PA | 1..183 | 1..183 | 930 | 96.7 | Plus |
Dpse\GA10323-PA | 156 | GA10323-PA | 43..127 | 20..103 | 146 | 40 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15851-PA | 183 | GM15851-PA | 1..183 | 1..183 | 957 | 100 | Plus |
Dsec\GM17376-PA | 156 | GM17376-PA | 43..127 | 20..103 | 145 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23986-PA | 183 | GD23986-PA | 1..183 | 1..183 | 957 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11838-PA | 179 | GJ11838-PA | 1..162 | 1..162 | 715 | 93.8 | Plus |
Dvir\GJ13578-PA | 154 | GJ13578-PA | 44..128 | 20..103 | 145 | 41.2 | Plus |