Clone GH16072 Report

Search the DGRC for GH16072

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:160
Well:72
Vector:pOT2
Associated Gene/TranscriptNC2beta-RA
Protein status:GH16072.pep: gold
Preliminary Size:839
Sequenced Size:718

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4185 2001-01-01 Release 2 assignment
CG4185 2001-10-10 Blastp of sequenced clone
CG4185 2003-01-01 Sim4 clustering to Release 3
NC2beta 2008-04-29 Release 5.5 accounting
NC2beta 2008-08-15 Release 5.9 accounting
NC2beta 2008-12-18 5.12 accounting

Clone Sequence Records

GH16072.complete Sequence

718 bp assembled on 2006-11-09

GenBank Submission: AY060717

> GH16072.complete
CACACTATACTAGTAAATCCGAGAAAAACATCTGCTTCCAAGTTTGTTTG
TTTGTTTGTTCCTTGAAACCAGGACGCCATGTCGAATCCGCAGGAAGAAC
TACTGCCGCCCAGCGCCGAGGACGACGAGCTGACCCTGCCACGGGCCAGC
ATCAACAAGATCATCAAGGAGCTGGTGCCCACGGTGCGGGTGGCCAACGA
GAGTCGCGAGCTGATACTCAACTGCTGCTCAGAGTTCATTCATCTGATCA
GTTCGGAGGCCAACGAGGTGTGCAACATGCGCAACAAGAAGACGATAAAC
GCAGAGCACGTCCTGGAGGCGTTGGAACGCTTGGGTTTTCACGACTACAA
ACAAGAGGCGGAGGCCGTTCTGCACGACTGCAAGGAGGTGGCAGCCAAGC
GAAGGCGCCAGAGCACGCGCCTAGAGAACCTGGGCATTCCGGAGGAGGAG
CTGCTGCGCCAGCAGCAGGAGCTGTTCGCCAAGGCACGCGAGGAGCAGGC
GCGCGAGGAGCAGCAGCAGTGGATGAGCATGCAAGCGGCAGCAATGGTGC
AGCGACCACCGCTGGCAGACGGCTCCGTTGCCAGCAAGCCAAGTGAGGAT
GACGATGACGATGACGACGACGACTACTAGTAGGAAATAGTCTTTCTATG
AGCTTAGTGTAGATTTAATCTTAAAATATATGCCATAAGTTGAACTTTCA
AAAAAAAAAAAAAAAAAA

GH16072.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
NC2beta-RA 720 NC2beta-RA 22..720 1..699 3495 100 Plus
NC2beta.a 660 NC2beta.a 34..660 73..699 3135 100 Plus
CG4103.a 1076 CG4103.a 1025..1076 701..650 260 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15006633..15007331 1..699 3465 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:55:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15007840..15008540 1..701 3505 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15007840..15008540 1..701 3505 100 Plus
Blast to na_te.dros performed 2019-03-16 10:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
G-element 4346 G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). 375..611 401..635 153 56.4 Plus

GH16072.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:12:10 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15006633..15007331 1..699 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:45:26 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 1..552 79..630 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:26 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 1..552 79..630 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:43 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 1..552 79..630 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:37:21 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 1..552 79..630 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:59:02 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 1..552 79..630 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:46 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 22..720 1..699 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:25 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 35..733 1..699 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:43 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 28..726 1..699 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:22 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 22..720 1..699 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:59:02 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
NC2beta-RA 28..726 1..699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:10 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15007840..15008538 1..699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:10 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15007840..15008538 1..699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:10 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15007840..15008538 1..699 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:43 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15007840..15008538 1..699 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:27 Download gff for GH16072.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15007840..15008538 1..699 100   Plus

GH16072.hyp Sequence

Translation from 2 to 595

> GH16072.hyp
HYTSKSEKNICFQVCLFVCSLKPGRHVESAGRTTAAQRRGRRADPATGQH
QQDHQGAGAHGAGGQRESRADTQLLLRVHSSDQFGGQRGVQHAQQEDDKR
RARPGGVGTLGFSRLQTRGGGRSARLQGGGSQAKAPEHAPREPGHSGGGA
AAPAAGAVRQGTRGAGARGAAAVDEHASGSNGAATTAGRRLRCQQAK*
Sequence GH16072.hyp has no blast hits.

GH16072.pep Sequence

Translation from 78 to 629

> GH16072.pep
MSNPQEELLPPSAEDDELTLPRASINKIIKELVPTVRVANESRELILNCC
SEFIHLISSEANEVCNMRNKKTINAEHVLEALERLGFHDYKQEAEAVLHD
CKEVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAREEQQQWMS
MQAAAMVQRPPLADGSVASKPSEDDDDDDDDDY*

GH16072.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14900-PA 183 GF14900-PA 1..172 1..172 802 96.5 Plus
Dana\GF14901-PA 77 GF14901-PA 4..77 110..183 238 94.6 Plus
Dana\GF14431-PA 150 GF14431-PA 38..122 20..103 146 41.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25136-PA 183 GG25136-PA 1..183 1..183 941 98.4 Plus
Dere\GG21205-PA 156 GG21205-PA 43..127 20..103 146 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10911-PA 198 GH10911-PA 1..198 1..183 707 84.8 Plus
Dgri\GH13827-PA 153 GH13827-PA 44..128 20..103 145 41.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
NC2beta-PA 183 CG4185-PA 1..183 1..183 935 100 Plus
Nf-YB-PB 156 CG10447-PB 43..127 20..103 142 41.2 Plus
Nf-YB-PA 156 CG10447-PA 43..127 20..103 142 41.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13215-PA 203 GI13215-PA 1..203 1..183 727 83.7 Plus
Dmoj\GI20193-PA 154 GI20193-PA 44..128 20..103 145 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26021-PA 183 GL26021-PA 1..183 1..183 930 96.7 Plus
Dper\GL26173-PA 156 GL26173-PA 43..127 20..103 146 40 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18013-PA 183 GA18013-PA 1..183 1..183 930 96.7 Plus
Dpse\GA10323-PA 156 GA10323-PA 43..127 20..103 146 40 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15851-PA 183 GM15851-PA 1..183 1..183 957 100 Plus
Dsec\GM17376-PA 156 GM17376-PA 43..127 20..103 145 41.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23986-PA 183 GD23986-PA 1..183 1..183 957 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11838-PA 179 GJ11838-PA 1..162 1..162 715 93.8 Plus
Dvir\GJ13578-PA 154 GJ13578-PA 44..128 20..103 145 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18069-PA 179 GK18069-PA 1..166 1..165 739 94 Plus
Dwil\GK14923-PA 156 GK14923-PA 43..127 20..103 145 41.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19055-PA 183 GE19055-PA 1..183 1..183 947 98.9 Plus
Dyak\GE13279-PA 156 GE13279-PA 43..127 20..103 145 41.2 Plus