Clone GH16267 Report

Search the DGRC for GH16267

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:162
Well:67
Vector:pOT2
Associated Gene/TranscriptCG17349-RA
Protein status:GH16267.pep: gold
Preliminary Size:1193
Sequenced Size:1116

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17349 2002-01-01 Sim4 clustering to Release 2
CG17349 2002-05-15 Blastp of sequenced clone
CG17349 2003-01-01 Sim4 clustering to Release 3
CG17349 2008-04-29 Release 5.5 accounting
CG17349 2008-08-15 Release 5.9 accounting
CG17349 2008-12-18 5.12 accounting

Clone Sequence Records

GH16267.complete Sequence

1116 bp (1116 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118792

> GH16267.complete
AAAAAACATCCGTGAATATTTTCTACACACCAAACTTAAAATCAAATCTT
CCAGACTTGCTTATTACAGACTTTGAAACTGAGGCTCCGCCCGCATCTTG
GTTTTTACATTTCTTTTTTTGGACATTAACTGATTTTAGTTCTACTAACA
ATGTGCACTAAGACAAACGAACGTGCCACTCGACTTCATGAACCTGGAAG
GGTTTGCAGGGAGTTGTTGTACCTCAGGTCGAAGGTGCCAGTACGTGAAG
TTCCCGCCTTCACTTTTCAGGCACTGCAGCCTAATACTGTGGTGAAACCT
CCTCCAAAGATCGACATTTTCAAGCGGAAGCCAGTGAAGGAGACCGTATT
CAAGATCTACTTCAATCGCGGCGACATTCCGTGTGTGATGTCCGGCAGGA
GCAGCAAACAGGATCCGACCAAGGAGCGTCCGGTGAAGTGGCACTGTGTG
CCGGAGAATCTCGACTATTGCTACTATCTGCCCATCTTCGTGGACGGACT
GGCGGACATGGACTACGACACCCGGTTGCTAGCGGTCAACGGAGCCATTG
ACCTCATCATGCGGTCCCCCAAAAAGGTGCTACCCGTGCTGCCCAAGCTC
ATTCTTCCTCTGAAACGGGCCTTCCAGACGCGCGACAAGCGGATCATCAT
CTCCGCCCTCCAAGTCATACAACTGATGGTCCGACTGGGTCCCTGTGTGG
GTCAGGCCCTGGTGCCCTTCTATCGCCAGTTGCTGGCCGTGTGCAATCTT
TACAAGAACATCAACGTGAATCTGGGAGAGGGTATCGATCCCGATCGAAA
CTGCCGCATCGGCGACGTCATCGAGGACACCCTGAAGCTGCTGGAGTACT
GCGGAGGCCCCAATGCCTTCATCAACATCAAGTACATGGTGCCCACCTAC
GAGAGCAGCGTCTTCCCCAAGTGCGAGGCGCCCGAGCCCCGGGAAGCCTA
ACATTTCCCATGGAAATGCCTAACTACCAGTTCGCTTTTCTTCGGCCTTC
AGCCTTCAGTTACCAAGAATTTGCGAACGAGTTTTAACCGCCAAATCGAA
GTTTGTGAACCTTCAAATCAGGGATGAGTAAAGCCAAAATTAATCATTAA
AAAAAAAAAAAAAAAA

GH16267.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17349-RA 1225 CG17349-RA 82..1180 1..1099 5495 100 Plus
CG15120-RA 1069 CG15120-RA 917..957 863..903 190 97.5 Plus
CG15120-RA 1069 CG15120-RA 754..795 706..747 150 90.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19370847..19371257 688..1098 2010 99.3 Plus
chr2L 23010047 chr2L 19369459..19369840 309..690 1880 99.5 Plus
chr2L 23010047 chr2L 19369028..19369263 1..237 1120 99.2 Plus
chr2L 23010047 chr2L 19369328..19369400 237..309 365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:55:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19372301..19372712 688..1099 2060 100 Plus
2L 23513712 2L 19370926..19371307 309..690 1910 100 Plus
2L 23513712 2L 19370494..19370730 1..237 1185 100 Plus
2L 23513712 2L 19370795..19370867 237..309 365 100 Plus
2R 25286936 2R 19500221..19500261 863..903 190 97.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19372301..19372712 688..1099 2060 100 Plus
2L 23513712 2L 19370926..19371307 309..690 1910 100 Plus
2L 23513712 2L 19370494..19370730 1..237 1185 100 Plus
2L 23513712 2L 19370795..19370867 237..309 365 100 Plus
2R 25260384 2R 19501420..19501460 863..903 190 97.5 Plus
2R 25260384 2R 19501189..19501230 706..747 150 90.4 Plus
Blast to na_te.dros performed on 2019-03-16 13:12:22 has no hits.

GH16267.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:13:16 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19369028..19369263 1..237 99 -> Plus
chr2L 19369329..19369399 238..308 100 -> Plus
chr2L 19369459..19369838 309..688 99 -> Plus
chr2L 19370848..19371257 689..1098 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:45:37 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 1..801 151..951 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:53 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 1..801 151..951 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:54:42 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 1..801 151..951 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:44:29 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 1..801 151..951 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:11:08 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 1..801 151..951 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:51 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 17..1114 1..1098 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:53 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 17..1114 1..1098 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:54:42 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 50..1147 1..1098 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:44:29 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 17..1114 1..1098 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:11:08 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
CG17349-RA 50..1147 1..1098 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:16 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19370494..19370730 1..237 100 -> Plus
2L 19370796..19370866 238..308 100 -> Plus
2L 19370926..19371305 309..688 100 -> Plus
2L 19372302..19372711 689..1098 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:16 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19370494..19370730 1..237 100 -> Plus
2L 19370796..19370866 238..308 100 -> Plus
2L 19370926..19371305 309..688 100 -> Plus
2L 19372302..19372711 689..1098 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:13:16 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19370494..19370730 1..237 100 -> Plus
2L 19370796..19370866 238..308 100 -> Plus
2L 19370926..19371305 309..688 100 -> Plus
2L 19372302..19372711 689..1098 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:54:42 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19370796..19370866 238..308 100 -> Plus
arm_2L 19370494..19370730 1..237 100 -> Plus
arm_2L 19370926..19371305 309..688 100 -> Plus
arm_2L 19372302..19372711 689..1098 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:50 Download gff for GH16267.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19370494..19370730 1..237 100 -> Plus
2L 19370796..19370866 238..308 100 -> Plus
2L 19370926..19371305 309..688 100 -> Plus
2L 19372302..19372711 689..1098 100   Plus

GH16267.hyp Sequence

Translation from 150 to 950

> GH16267.hyp
MCTKTNERATRLHEPGRVCRELLYLRSKVPVREVPAFTFQALQPNTVVKP
PPKIDIFKRKPVKETVFKIYFNRGDIPCVMSGRSSKQDPTKERPVKWHCV
PENLDYCYYLPIFVDGLADMDYDTRLLAVNGAIDLIMRSPKKVLPVLPKL
ILPLKRAFQTRDKRIIISALQVIQLMVRLGPCVGQALVPFYRQLLAVCNL
YKNINVNLGEGIDPDRNCRIGDVIEDTLKLLEYCGGPNAFINIKYMVPTY
ESSVFPKCEAPEPREA*

GH16267.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG17349-PA 266 CG17349-PA 1..266 1..266 1412 100 Plus
CG15120-PA 308 CG15120-PA 49..304 32..252 415 38.9 Plus

GH16267.pep Sequence

Translation from 150 to 950

> GH16267.pep
MCTKTNERATRLHEPGRVCRELLYLRSKVPVREVPAFTFQALQPNTVVKP
PPKIDIFKRKPVKETVFKIYFNRGDIPCVMSGRSSKQDPTKERPVKWHCV
PENLDYCYYLPIFVDGLADMDYDTRLLAVNGAIDLIMRSPKKVLPVLPKL
ILPLKRAFQTRDKRIIISALQVIQLMVRLGPCVGQALVPFYRQLLAVCNL
YKNINVNLGEGIDPDRNCRIGDVIEDTLKLLEYCGGPNAFINIKYMVPTY
ESSVFPKCEAPEPREA*

GH16267.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14715-PA 266 GF14715-PA 1..266 1..266 1344 95.1 Plus
Dana\GF11719-PA 310 GF11719-PA 119..306 61..252 414 44.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21171-PA 266 GG21171-PA 1..266 1..266 1387 98.5 Plus
Dere\GG21981-PA 308 GG21981-PA 49..304 32..252 422 38.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13446-PA 274 GH13446-PA 6..270 2..266 1167 81.9 Plus
Dgri\GH12932-PA 274 GH12932-PA 6..270 2..266 1163 81.5 Plus
Dgri\GH23003-PA 308 GH23003-PA 120..304 64..252 404 44.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG17349-PA 266 CG17349-PA 1..266 1..266 1412 100 Plus
CG15120-PA 308 CG15120-PA 49..304 32..252 415 38.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14007-PA 274 GI14007-PA 6..270 2..266 1192 83.4 Plus
Dmoj\GI18969-PA 305 GI18969-PA 111..301 58..252 411 43.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21201-PA 264 GL21201-PA 1..263 1..263 1237 88.2 Plus
Dper\GL21291-PA 312 GL21291-PA 54..308 32..252 404 37.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14474-PA 264 GA14474-PA 1..263 1..263 1231 87.8 Plus
Dpse\GA13509-PA 312 GA13509-PA 54..308 32..252 404 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17338-PA 266 GM17338-PA 1..266 1..266 1396 100 Plus
Dsec\GM21969-PA 308 GM21969-PA 49..304 32..252 421 38.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24196-PA 266 GD24196-PA 1..266 1..266 1396 100 Plus
Dsim\GD11462-PA 109 GD11462-PA 1..105 150..252 259 51.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18253-PA 274 GJ18253-PA 6..266 2..262 1176 83.9 Plus
Dvir\GJ20913-PA 305 GJ20913-PA 49..301 32..252 408 38.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23829-PA 266 GK23829-PA 1..264 1..264 1201 86.7 Plus
Dwil\GK15876-PA 310 GK15876-PA 121..306 63..252 408 44.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13244-PA 266 GE13244-PA 1..266 1..266 1386 98.5 Plus
Dyak\GE12060-PA 308 GE12060-PA 49..304 32..252 422 38.9 Plus