Clone GH16689 Report

Search the DGRC for GH16689

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:166
Well:89
Vector:pOT2
Associated Gene/TranscriptTal-RA
Protein status:GH16689.pep: gold
Sequenced Size:1080

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Tal 2008-04-29 Picked prior to 5.5
Tal 2008-08-15 Release 5.9 accounting
Tal 2008-12-18 5.12 accounting

Clone Sequence Records

GH16689.complete Sequence

1080 bp assembled on 2008-05-14

GenBank Submission: BT032685

> GH16689.complete
AATGGGAAGTGATCGCACGTTAAAAAAGCAAAAGATGTCGGTATTACAGG
AACTCAAGAAAATCACCACAATTGTGGCTGACACCGGCGACTTTGAAGCC
ATCAACATCTATAAGCCCACGGATGCCACCACTAATCCCTCCCTCATCTT
GTCCGCTTCGTCCATGGAGCGGTACCAGCCGCTGGTCCAAAAGGCGGTGG
AATACGCCAAGGGCAAGAAGGGCTCCGTGAGTGAGCAGGTGGCCGAGGCC
ATGGACTACCTGTGCGTGCTGTTCGGAACGGAAATCCTGAAGGTTGTGCC
CGGTCGCGTTTCCACCGAGATCGATGCCCGCTTGTCCTTCGACACCAAGA
AGAGCGTGGAGAAGGCCCTGAAGCTGATCGCCCTGTACAAATCCCTGGGC
GTCGACAAGGAGCGAATTCTGATCAAGCTGGCGTCCACCTGGGAGGGCAT
CAAGGCGGCCGAGATCCTGGAGAACGAGCACGGTGTGCACTGCAACCTGA
CGCTCCTTTTCTCGTTCGCACAGGCCGTGGCTTGCGCCGAGGCCGGCGTG
ACCCTCATCTCCCCGTTCGTGGGCCGCATCCTGGACTGGTACGTGGCCAA
CACGGATACCAAGAAGTTCGAGGCGCTCAAGGACCCGGGCGTGATCTCCG
TGACGAACATCTACAACTACTACAAGAAGTTCGGCTACAAGACCCTGGTC
ATGGGCGCCTCCTTCCGTAACGTGGGCGAAATCAAGGCCCTGGCTGGCTG
CGATCTGCTTACCATCAGCCCAGCGCTGCTTAAGGAGCTGGAGAACGAGA
CCGAGTCGGTGGTCACCTACCTGTCCGTAAGCAACGCCAAGCTGCAGGAC
ATCGAGAAGATCACCGTCGATGAGAGCCGGTTCCGCTGGCTGCTCAACGA
GGACGCCATGGCCACCGACAAACTTTCCGAGGGCATCAGGAAGTTCGCCG
TGGATACTGTTAAGCTGGAGAATTTGATTAAGACCTATCTTAAGTAGATG
TTCCTCTGGGTCCGCTAGCAGGTGGAGGATGAATACATTCGTTTTTGAAA
AAGACAAAAAAAAAAAAAAAAAAAAAAAAA

GH16689.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Tal-RA 1324 Tal-RA 129..1185 1..1057 5285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19827299..19828132 222..1055 4035 98.9 Plus
chr2R 21145070 chr2R 19827115..19827240 97..222 600 98.4 Plus
chr2R 21145070 chr2R 19826489..19826586 1..98 490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:55:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23941239..23942074 222..1057 4180 100 Plus
2R 25286936 2R 23941055..23941180 97..222 630 100 Plus
2R 25286936 2R 23940429..23940526 1..98 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23942438..23943273 222..1057 4180 100 Plus
2R 25260384 2R 23942254..23942379 97..222 630 100 Plus
2R 25260384 2R 23941628..23941725 1..98 490 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:19:03 has no hits.

GH16689.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:19:52 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19827117..19827240 99..222 98 -> Plus
chr2R 19826489..19826586 1..98 100 -> Plus
chr2R 19827300..19828132 223..1055 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:46:06 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 1..996 2..997 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:48:43 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 1..996 2..997 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:45 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 1..996 2..997 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:48:10 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 1..996 2..997 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:16:10 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 1..996 2..997 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:11:44 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 17..1071 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:48:43 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 17..1071 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:45 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 20..1074 1..1055 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:48:10 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 17..1071 1..1055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:16:10 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
Tal-RA 20..1074 1..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:52 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23941240..23942072 223..1055 100   Plus
2R 23940429..23940526 1..98 100 -> Plus
2R 23941057..23941180 99..222 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:52 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23941240..23942072 223..1055 100   Plus
2R 23940429..23940526 1..98 100 -> Plus
2R 23941057..23941180 99..222 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:19:52 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23941240..23942072 223..1055 100   Plus
2R 23940429..23940526 1..98 100 -> Plus
2R 23941057..23941180 99..222 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:45 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19827952..19828049 1..98 100 -> Plus
arm_2R 19828580..19828703 99..222 100 -> Plus
arm_2R 19828763..19829595 223..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:27:58 Download gff for GH16689.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23941646..23941743 1..98 100 -> Plus
2R 23942274..23942397 99..222 100 -> Plus
2R 23942457..23943289 223..1055 100   Plus

GH16689.hyp Sequence

Translation from 0 to 996

> GH16689.hyp
MGSDRTLKKQKMSVLQELKKITTIVADTGDFEAINIYKPTDATTNPSLIL
SASSMERYQPLVQKAVEYAKGKKGSVSEQVAEAMDYLCVLFGTEILKVVP
GRVSTEIDARLSFDTKKSVEKALKLIALYKSLGVDKERILIKLASTWEGI
KAAEILENEHGVHCNLTLLFSFAQAVACAEAGVTLISPFVGRILDWYVAN
TDTKKFEALKDPGVISVTNIYNYYKKFGYKTLVMGASFRNVGEIKALAGC
DLLTISPALLKELENETESVVTYLSVSNAKLQDIEKITVDESRFRWLLNE
DAMATDKLSEGIRKFAVDTVKLENLIKTYLK*

GH16689.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Tal-PA 331 CG2827-PA 1..331 1..331 1651 100 Plus

GH16689.pep Sequence

Translation from 1 to 996

> GH16689.pep
MGSDRTLKKQKMSVLQELKKITTIVADTGDFEAINIYKPTDATTNPSLIL
SASSMERYQPLVQKAVEYAKGKKGSVSEQVAEAMDYLCVLFGTEILKVVP
GRVSTEIDARLSFDTKKSVEKALKLIALYKSLGVDKERILIKLASTWEGI
KAAEILENEHGVHCNLTLLFSFAQAVACAEAGVTLISPFVGRILDWYVAN
TDTKKFEALKDPGVISVTNIYNYYKKFGYKTLVMGASFRNVGEIKALAGC
DLLTISPALLKELENETESVVTYLSVSNAKLQDIEKITVDESRFRWLLNE
DAMATDKLSEGIRKFAVDTVKLENLIKTYLK*

GH16689.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12877-PA 320 GF12877-PA 1..320 12..331 1604 95.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22905-PA 320 GG22905-PA 1..320 12..331 1662 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21694-PA 331 GH21694-PA 1..331 1..331 1480 84.3 Plus
Dgri\GH14637-PA 319 GH14637-PA 1..317 12..328 1250 71.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
Taldo-PA 331 CG2827-PA 1..331 1..331 1651 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18849-PA 320 GI18849-PA 1..316 12..327 1376 86.1 Plus
Dmoj\GI22416-PA 319 GI22416-PA 1..317 12..328 1178 72.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11180-PA 320 GL11180-PA 1..320 12..331 1542 89.7 Plus
Dper\GL10936-PA 106 GL10936-PA 8..106 30..128 431 82.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24634-PA 320 GA24634-PA 1..320 12..331 1545 90 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16065-PA 320 GM16065-PA 1..320 12..331 1668 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11811-PA 320 GD11811-PA 1..320 12..331 1675 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21882-PA 331 GJ21882-PA 1..331 1..331 1446 81.9 Plus
Dvir\GJ10976-PA 319 GJ10976-PA 1..319 12..330 1304 75.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15717-PA 320 GK15717-PA 1..320 12..331 1552 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Tal-PA 320 GE14343-PA 1..320 12..331 1667 99.4 Plus