Clone GH16758 Report

Search the DGRC for GH16758

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:167
Well:58
Vector:pOT2
Associated Gene/TranscriptCG6115-RA
Protein status:GH16758.pep: gold
Preliminary Size:523
Sequenced Size:721

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6115 2002-01-01 Sim4 clustering to Release 2
CG6115 2002-05-18 Blastp of sequenced clone
CG6115 2003-01-01 Sim4 clustering to Release 3
CG6115 2008-04-29 Release 5.5 accounting
CG6115 2008-08-15 Release 5.9 accounting
CG6115 2008-12-18 5.12 accounting

Clone Sequence Records

GH16758.complete Sequence

721 bp (721 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118795

> GH16758.complete
TGATTCACTTCGCTTGAAATAAAATAAACAAAAAGCAGAGAAAAGCTTCT
GCAAATCAGTTGTTAACTTGCATTTAACAAACAAACCAATTCCGCTGACC
ACTGGTGATGTCACAGCTGCGCTCGAAAGTCATTAGCCTCTACAAGCACT
TGCAGTATTTGGGCCGCGAATATCCCGGCCTGAACGGGCCGCAGAAGTTC
AGGAAGCAGATCCACGATGCCTTCATGAACCACAAGGACGAGCAGGATCC
CAAGAAGATCGTCGCCCTGCTAGCCCAAGGACGTTACTTGGCCAAGGAGG
TGGAGGCCCTGTACTCGCTGAAGAAGTACCGAAGTGTCAAGCAGCGCTAT
AGTTACAATGACTAAGTGGGCGGAACGTAAATCGGCGGGCGGGAGGCGTG
GCAGCGATGCGGAAATCGCTGCAAAAACTCAAGGACTGATGCTGTGGATC
GGGGGGAGCACGAAGAAGGAGGTGTAGAAAGAATCATGAGAATATGATAC
GTTTCGCCTTGCTTGTCGCACACAAAAACTAAAAAAATATATACATACTG
AAATGCATATTGTTCGGCCAAAAGAAACGTAACCCAAAACACACAATAAT
AATTTCGAATGTCTTGTCAATGTCCAACTTAAAGTTTGTTATTGAGGCAC
CCAAAAAAAAGCGAAAAACGGACGTAGCGAATAAACGAAGCAGTCATTGA
ATAAAAAAAAAAAAAAAAAAA

GH16758.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG6115-RA 854 CG6115-RA 90..794 1..705 3525 100 Plus
CG6115.a 699 CG6115.a 1..699 1..705 3410 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16885782..16886338 702..146 2755 99.6 Minus
chr2L 23010047 chr2L 16886450..16886598 149..1 745 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:55:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16887122..16887681 705..146 2785 99.8 Minus
2L 23513712 2L 16887793..16887941 149..1 745 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16887122..16887681 705..146 2785 99.8 Minus
2L 23513712 2L 16887793..16887941 149..1 745 100 Minus
Blast to na_te.dros performed 2019-03-15 20:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
baggins 5453 baggins BAGGINS 5453bp 712..769 92..36 107 67.2 Minus

GH16758.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:16:38 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16885782..16886334 150..702 99 <- Minus
chr2L 16886450..16886598 1..149 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:46:13 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 1..258 108..365 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:01:33 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 1..258 108..365 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:05:16 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 1..258 108..365 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:52:00 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 1..258 108..365 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:26 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 1..258 108..365 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:19:21 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:01:33 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 22..723 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:05:16 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 26..727 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:52:00 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:26 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
CG6115-RA 26..727 1..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:38 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16887125..16887677 150..702 100 <- Minus
2L 16887793..16887941 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:38 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16887125..16887677 150..702 100 <- Minus
2L 16887793..16887941 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:38 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16887125..16887677 150..702 100 <- Minus
2L 16887793..16887941 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:05:16 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16887125..16887677 150..702 100 <- Minus
arm_2L 16887793..16887941 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:23:54 Download gff for GH16758.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16887125..16887677 150..702 100 <- Minus
2L 16887793..16887941 1..149 100   Minus

GH16758.hyp Sequence

Translation from 107 to 364

> GH16758.hyp
MSQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKK
IVALLAQGRYLAKEVEALYSLKKYRSVKQRYSYND*

GH16758.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG6115-PB 85 CG6115-PB 1..85 1..85 441 100 Plus
CG6115-PA 85 CG6115-PA 1..85 1..85 441 100 Plus

GH16758.pep Sequence

Translation from 107 to 364

> GH16758.pep
MSQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKK
IVALLAQGRYLAKEVEALYSLKKYRSVKQRYSYND*

GH16758.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15116-PA 85 GF15116-PA 1..85 1..85 437 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21763-PA 85 GG21763-PA 1..85 1..85 437 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13769-PA 85 GH13769-PA 1..85 1..85 405 89.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG6115-PB 85 CG6115-PB 1..85 1..85 441 100 Plus
CG6115-PA 85 CG6115-PA 1..85 1..85 441 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17909-PA 83 GI17909-PA 1..82 1..82 392 90.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16063-PA 85 GL16063-PA 1..85 1..85 422 95.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19363-PA 85 GA19363-PA 1..85 1..85 422 95.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17148-PA 85 GM17148-PA 1..85 1..85 439 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21888-PA 85 GD21888-PA 1..85 1..85 439 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17417-PA 92 GJ17417-PA 1..85 1..85 395 89.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18147-PA 86 GK18147-PA 3..86 2..85 414 92.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13153-PA 85 GE13153-PA 1..85 1..85 437 98.8 Plus