Clone GH17451 Report

Search the DGRC for GH17451

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:174
Well:51
Vector:pOT2
Associated Gene/Transcriptyellow-f2-RA
Protein status:GH17451.pep: gold
Preliminary Size:1593
Sequenced Size:1481

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8063 2001-01-01 Release 2 assignment
CG8063 2001-10-10 Blastp of sequenced clone
CG8063 2003-01-01 Sim4 clustering to Release 3
yellow-f2 2008-04-29 Release 5.5 accounting
yellow-f2 2008-08-15 Release 5.9 accounting
yellow-f2 2008-12-18 5.12 accounting

Clone Sequence Records

GH17451.complete Sequence

1481 bp (1481 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060728

> GH17451.complete
GCAAGGCGAACTTAGATTATAGTTCCCCAGGAAAACCGAGCAATGTTATC
GCCCCAATTTTTGATTCTAAGTTTAATCTCAGGGTTACAGCTGCTTTCCT
TGGCAGATGCTGATCCCATGATAGAGGTCTTCCGATGGAAGCAGATGGAC
TTTTACAATCGCGGAGATGGCCATCTAAGCTCGGGCGGAAGGAAAGACAG
GCCCAGCTTTTCAGCTCCGGTTGTCTTTCCTGGAAAGTATTCTCGTCGAA
AGCGTAAGATTATGACCTCCCGCGATACACCGGTAGTGGTCAGCTCCCGC
GCCGACAGCGACGACCCCAACGCCTCCTACATTCCGTACAATAACGTGCC
CATGGGAGCCACTCACTTCCGCGGCCGCCTCTTTGTCACGATGCCTCGTC
GACGGGTGGGCATCCCATCCACCTTGAATTACATCGATCTGGCCGAGGAC
GGATCGAATCGCAGCCCCAAGCTGCGGGCCTATCCCAACTTTGCGCTTAA
TCAGTTCAACGCGAGTGCGGAGAATCTGGTGTCCGTCTACAGAACCTCCG
TGGATGCATGCCAGCGTCTCTGGTTTATCGACACGGGAATGCTGGAGTAT
CCAAATAACCGCCAACAGATCCGCCGTCCCAGCATTTGGGTAGTTGACTT
GGCCACGGATCAGGTGCTGAAGCGCTTCGATGTTCCGGAGAGTATAGCTG
AGACGGGTCGCGGATTGGCCAGCATCACCGTGGATGTGAAGGCGGGTCAG
TGTGGCGATGCCTACGCCTATATTCCGGATCTGGTGTACCGGCGCCTGTA
CGTCTATCACCTGCGAAACGATAGAATCTGGTCCTTCGAGCACAACTACT
TCAACTTCGATCCGCTGTCCGGGGATCTCAGCATTGGCGGCCAGACCTTC
CGCTGGGACGATGGCATCTTCTCAATAACTTTGGGGGCCCAGAAACTGGA
TGGGAGCCGCGATGCCTACTTCCATCCCATGGCCAGTACGAATGAGTTTG
TGGTCTCCAACCGGGTTCTGCAGCAGGAATCCAACGCCGCACGTTCCGAT
CATGGGAACGATTTCCGGGTACTCGGAAGCCGTGGTCCGTCCACCCAGTC
TACGATGCACGCTTACGATCCTGGGACTGGGGTGATCTTCTTCGATGAGA
TCCAGCGCAACGGAGTGGGCTGCTGGAAGACCAGCAAGCCCATCTCGGCG
GAAAACTATGGCTCTGTGGATTCCAATGCCGAGGATATGATTTATCCCAG
CGACTTGTCGATTGACGAGGATGGCACCATTTGGGTCATGTCCAACTCCA
TGCCCATCTTCATCTACTCCACACTGGACACGAGTATATACAATTTCCGG
ATTTGGAAGCAGAAGGCTTCACTGGCCAAGAGGGGCACAGTTTGTGAGTG
ATTCGTGTGGAATTCCTGTTGAATTTGTTACTTAATTAAAAATACATACA
TAAGTAAGAATGAAAAAAAAAAAAAAAAAAA

GH17451.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-f2-RA 1697 yellow-f2-RA 148..1610 1..1463 7315 100 Plus
yellow-f.a 1429 yellow-f.a 870..1249 949..1328 790 80.5 Plus
yellow-f.b 1458 yellow-f.b 899..1278 949..1328 790 80.5 Plus
yellow-f.a 1429 yellow-f.a 258..659 337..738 630 77.1 Plus
yellow-f.b 1458 yellow-f.b 287..688 337..738 630 77.1 Plus
yellow-f.a 1429 yellow-f.a 677..844 756..923 420 83.3 Plus
yellow-f.b 1458 yellow-f.b 706..873 756..923 420 83.3 Plus
yellow-f.a 1429 yellow-f.a 98..194 75..171 245 83.5 Plus
yellow-f.b 1458 yellow-f.b 142..238 75..171 245 83.5 Plus
yellow-f.a 1429 yellow-f.a 1260..1335 1339..1414 200 84.2 Plus
yellow-f.b 1458 yellow-f.b 1289..1364 1339..1414 200 84.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8818921..8819583 1260..598 3285 99.7 Minus
chr3R 27901430 chr3R 8819685..8820076 604..213 1945 99.7 Minus
chr3R 27901430 chr3R 8817002..8817654 1257..605 1045 77.3 Minus
chr3R 27901430 chr3R 8818652..8818854 1462..1260 1015 100 Minus
chr3R 27901430 chr3R 8820191..8820404 214..1 1010 98.1 Minus
chr3R 27901430 chr3R 8817723..8817988 602..337 505 79.3 Minus
chr3R 27901430 chr3R 8816784..8816938 1414..1260 310 80 Minus
chr3R 27901430 chr3R 8818274..8818370 171..75 245 83.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:56:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12993664..12994326 1260..598 3300 99.8 Minus
3R 32079331 3R 12994428..12994819 604..213 1960 100 Minus
3R 32079331 3R 12994934..12995147 214..1 1070 100 Minus
3R 32079331 3R 12991747..12992399 1257..605 1030 77.2 Minus
3R 32079331 3R 12993394..12993597 1463..1260 1020 100 Minus
3R 32079331 3R 12992468..12992733 602..337 505 79.3 Minus
3R 32079331 3R 12991529..12991683 1414..1260 310 80 Minus
3R 32079331 3R 12993017..12993113 171..75 245 83.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12734495..12735157 1260..598 3300 99.8 Minus
3R 31820162 3R 12735259..12735650 604..213 1960 100 Minus
3R 31820162 3R 12735765..12735978 214..1 1070 100 Minus
3R 31820162 3R 12734225..12734428 1463..1260 1020 100 Minus
3R 31820162 3R 12732578..12732886 1257..949 630 80.2 Minus
3R 31820162 3R 12733299..12733564 602..337 505 79.3 Minus
3R 31820162 3R 12732912..12733079 923..756 420 83.3 Minus
3R 31820162 3R 12733848..12733944 171..75 245 83.5 Minus
3R 31820162 3R 12732360..12732435 1414..1339 200 84.2 Minus
3R 31820162 3R 12732446..12732514 1328..1260 180 84 Minus
Blast to na_te.dros performed on 2019-03-15 18:09:04 has no hits.

GH17451.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:09:45 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8818652..8818853 1261..1462 100 <- Minus
chr3R 8818921..8819576 605..1260 99 <- Minus
chr3R 8819685..8820074 215..604 99 <- Minus
chr3R 8820191..8820404 1..214 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:46:50 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1359 43..1401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:37:34 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1359 43..1401 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:54:37 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1359 43..1401 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:06:26 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1359 43..1401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:54:18 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1359 43..1401 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:18:15 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1462 1..1462 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:37:34 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1462 1..1462 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:54:37 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1462 1..1462 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:06:27 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1462 1..1462 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:54:18 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-f2-RA 1..1462 1..1462 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:45 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12993395..12993596 1261..1462 100 <- Minus
3R 12993664..12994319 605..1260 100 <- Minus
3R 12994428..12994817 215..604 100 <- Minus
3R 12994934..12995147 1..214 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:45 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12993395..12993596 1261..1462 100 <- Minus
3R 12993664..12994319 605..1260 100 <- Minus
3R 12994428..12994817 215..604 100 <- Minus
3R 12994934..12995147 1..214 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:45 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12993395..12993596 1261..1462 100 <- Minus
3R 12993664..12994319 605..1260 100 <- Minus
3R 12994428..12994817 215..604 100 <- Minus
3R 12994934..12995147 1..214 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:54:37 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8819117..8819318 1261..1462 100 <- Minus
arm_3R 8819386..8820041 605..1260 100 <- Minus
arm_3R 8820150..8820539 215..604 100 <- Minus
arm_3R 8820656..8820869 1..214 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:42:28 Download gff for GH17451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12734495..12735150 605..1260 100 <- Minus
3R 12735259..12735648 215..604 100 <- Minus
3R 12735765..12735978 1..214 100   Minus
3R 12734226..12734427 1261..1462 100 <- Minus

GH17451.pep Sequence

Translation from 42 to 1400

> GH17451.pep
MLSPQFLILSLISGLQLLSLADADPMIEVFRWKQMDFYNRGDGHLSSGGR
KDRPSFSAPVVFPGKYSRRKRKIMTSRDTPVVVSSRADSDDPNASYIPYN
NVPMGATHFRGRLFVTMPRRRVGIPSTLNYIDLAEDGSNRSPKLRAYPNF
ALNQFNASAENLVSVYRTSVDACQRLWFIDTGMLEYPNNRQQIRRPSIWV
VDLATDQVLKRFDVPESIAETGRGLASITVDVKAGQCGDAYAYIPDLVYR
RLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGAQ
KLDGSRDAYFHPMASTNEFVVSNRVLQQESNAARSDHGNDFRVLGSRGPS
TQSTMHAYDPGTGVIFFDEIQRNGVGCWKTSKPISAENYGSVDSNAEDMI
YPSDLSIDEDGTIWVMSNSMPIFIYSTLDTSIYNFRIWKQKASLAKRGTV
CE*

GH17451.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18090-PA 452 GF18090-PA 1..452 1..452 1967 80.4 Plus
Dana\GF14904-PA 438 GF14904-PA 52..437 93..452 817 38.7 Plus
Dana\y-PA 546 GF21448-PA 55..408 96..452 636 38.4 Plus
Dana\GF15359-PA 453 GF15359-PA 48..403 94..452 598 33.4 Plus
Dana\GF19909-PA 404 GF19909-PA 32..403 81..451 346 26.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17085-PA 452 GG17085-PA 1..452 1..452 2217 93.4 Plus
Dere\GG17086-PA 432 GG17086-PA 1..432 1..452 1729 71 Plus
Dere\GG25141-PA 434 GG25141-PA 52..433 93..452 794 38.4 Plus
Dere\y-PA 541 GG12780-PA 53..406 96..452 647 38.7 Plus
Dere\GG22769-PA 453 GG22769-PA 50..403 96..452 607 35 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19199-PA 446 GH19199-PA 22..446 23..452 1702 74.5 Plus
Dgri\GH10914-PA 435 GH10914-PA 39..434 84..452 802 38.9 Plus
Dgri\GH24338-PA 546 GH24338-PA 51..404 96..452 625 37.9 Plus
Dgri\GH11563-PA 464 GH11563-PA 49..403 93..452 622 34.7 Plus
Dgri\GH23996-PA 455 GH23996-PA 71..432 93..451 561 35.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-f2-PA 452 CG8063-PA 1..452 1..452 2385 100 Plus
yellow-f-PA 429 CG18550-PA 1..429 1..452 1666 69.5 Plus
yellow-f-PB 418 CG18550-PB 1..418 1..452 1654 69.2 Plus
yellow-f-PC 413 CG18550-PC 1..413 1..452 1646 69 Plus
yellow-c-PB 438 CG4182-PB 52..437 93..452 812 39.2 Plus
yellow-c-PA 438 CG4182-PA 52..437 93..452 812 39.2 Plus
y-PA 541 CG3757-PA 50..406 93..452 645 38.1 Plus
yellow-b-PB 453 CG17914-PB 52..403 98..452 609 34.6 Plus
yellow-b-PA 453 CG17914-PA 52..403 98..452 609 34.6 Plus
yellow-h-PA 463 CG1629-PA 78..440 93..451 579 35.1 Plus
yellow-d-PA 432 CG9889-PA 83..409 112..441 339 28.1 Plus
yellow-e2-PB 435 CG17044-PB 42..434 59..451 335 27.1 Plus
yellow-e-PA 530 CG9792-PA 41..385 86..437 312 26.8 Plus
yellow-d2-PA 412 CG9891-PA 73..399 113..439 304 26.2 Plus
yellow-e3-PA 409 CG17045-PA 57..383 110..437 242 25.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24232-PA 417 GI24232-PA 1..417 35..452 1652 73.5 Plus
Dmoj\GI13248-PA 432 GI13248-PA 49..431 96..452 817 39.2 Plus
Dmoj\GI21724-PA 543 GI21724-PA 58..411 96..452 629 38.2 Plus
Dmoj\GI17054-PA 454 GI17054-PA 49..402 94..452 602 35.5 Plus
Dmoj\GI11002-PA 470 GI11002-PA 81..446 93..451 588 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23151-PA 436 GL23151-PA 1..436 26..452 1864 78.4 Plus
Dper\GL26025-PA 438 GL26025-PA 55..437 96..452 808 39 Plus
Dper\GL18784-PA 454 GL18784-PA 50..403 96..452 652 36.1 Plus
Dper\GL20376-PA 482 GL20376-PA 62..415 96..452 645 38.7 Plus
Dper\GL18156-PA 466 GL18156-PA 80..443 93..451 614 36.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27163-PA 460 GA27163-PA 1..460 1..452 1874 76.1 Plus
Dpse\GA18010-PA 438 GA18010-PA 55..437 96..452 808 39 Plus
Dpse\GA14722-PA 454 GA14722-PA 50..403 96..452 648 36.1 Plus
Dpse\y-PA 560 GA17665-PA 15..415 7..452 644 34.4 Plus
Dpse\GA27858-PA 427 GA27858-PA 41..404 93..451 617 36.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25968-PA 452 GM25968-PA 1..452 1..452 2269 95.1 Plus
Dsec\GM25969-PA 434 GM25969-PA 1..434 1..452 1670 69.5 Plus
Dsec\GM15882-PA 438 GM15882-PA 52..437 93..452 816 39.2 Plus
Dsec\GM17203-PA 453 GM17203-PA 50..403 96..452 619 34.7 Plus
Dsec\y-PA 426 GM19059-PA 53..328 96..374 460 37.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20528-PA 452 GD20528-PA 1..452 1..452 2345 96.7 Plus
Dsim\GD20529-PA 429 GD20529-PA 1..429 1..452 1681 70.4 Plus
Dsim\GD23989-PA 438 GD23989-PA 52..437 93..452 816 39.2 Plus
Dsim\GD24079-PA 453 GD24079-PA 50..403 96..452 616 34.5 Plus
Dsim\y-PA 406 GD24705-PA 53..328 96..374 462 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10805-PA 452 GJ10805-PA 5..452 7..452 1738 71.7 Plus
Dvir\GJ11869-PA 435 GJ11869-PA 52..434 96..452 830 40 Plus
Dvir\y-PA 541 GJ15591-PA 55..408 96..452 622 38.4 Plus
Dvir\GJ17304-PA 466 GJ17304-PA 51..405 93..452 614 34.2 Plus
Dvir\GJ14923-PA 455 GJ14923-PA 67..432 93..451 569 35 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10856-PA 453 GK10856-PA 3..453 5..452 1625 67.8 Plus
Dwil\GK12212-PA 404 GK12212-PA 1..404 26..452 1466 64.6 Plus
Dwil\GK18310-PA 436 GK18310-PA 53..435 96..452 832 40.5 Plus
Dwil\GK25268-PA 545 GK25268-PA 57..410 96..452 645 38.7 Plus
Dwil\GK13672-PA 468 GK13672-PA 80..445 93..452 598 35.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24474-PA 452 GE24474-PA 1..452 1..452 2285 93.8 Plus
Dyak\GE24475-PA 434 GE24475-PA 1..434 1..452 1704 70.8 Plus
Dyak\GE20803-PA 438 GE20803-PA 52..437 93..452 809 38.4 Plus
Dyak\y-PA 541 GE16608-PA 53..406 96..452 651 38.7 Plus
Dyak\GE12764-PA 453 GE12764-PA 50..403 96..452 618 35 Plus

GH17451.hyp Sequence

Translation from 42 to 1400

> GH17451.hyp
MLSPQFLILSLISGLQLLSLADADPMIEVFRWKQMDFYNRGDGHLSSGGR
KDRPSFSAPVVFPGKYSRRKRKIMTSRDTPVVVSSRADSDDPNASYIPYN
NVPMGATHFRGRLFVTMPRRRVGIPSTLNYIDLAEDGSNRSPKLRAYPNF
ALNQFNASAENLVSVYRTSVDACQRLWFIDTGMLEYPNNRQQIRRPSIWV
VDLATDQVLKRFDVPESIAETGRGLASITVDVKAGQCGDAYAYIPDLVYR
RLYVYHLRNDRIWSFEHNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGAQ
KLDGSRDAYFHPMASTNEFVVSNRVLQQESNAARSDHGNDFRVLGSRGPS
TQSTMHAYDPGTGVIFFDEIQRNGVGCWKTSKPISAENYGSVDSNAEDMI
YPSDLSIDEDGTIWVMSNSMPIFIYSTLDTSIYNFRIWKQKASLAKRGTV
CE*

GH17451.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-f2-PA 452 CG8063-PA 1..452 1..452 2385 100 Plus
yellow-f-PA 429 CG18550-PA 1..429 1..452 1666 69.5 Plus
yellow-f-PB 418 CG18550-PB 1..418 1..452 1654 69.2 Plus
yellow-f-PC 413 CG18550-PC 1..413 1..452 1646 69 Plus
yellow-c-PB 438 CG4182-PB 52..437 93..452 812 39.2 Plus