Clone GH17639 Report

Search the DGRC for GH17639

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:176
Well:39
Vector:pOT2
Associated Gene/TranscriptTrs31-RA
Protein status:GH17639.pep: gold
Preliminary Size:827
Sequenced Size:669

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10153 2001-01-01 Release 2 assignment
CG10153 2001-10-10 Blastp of sequenced clone
CG10153 2003-01-01 Sim4 clustering to Release 3
CG10153 2008-04-29 Release 5.5 accounting
CG10153 2008-08-15 Release 5.9 accounting
CG10153 2008-12-18 5.12 accounting

Clone Sequence Records

GH17639.complete Sequence

669 bp (669 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060730

> GH17639.complete
CACACTTTGCATTGTTTTGGAAAATAATTTGATACATTTATCAGGAAAAT
GGAAAAACTGGAGGCCCTAAAAATATCCTCGATGCGTCCGCGCAGCAACA
TCCTAGACAGACCACTATCCAAGGGCAAAACGGAGGTTTCCCAGAGCATT
GTGGCGCTGCTTTTCAGCGAAATCGTCCAGTACTCGCAGAGCCGAGTGTT
TACAGTCCCAGAATTGCAAACAAGACTCCACGATCTGGGTCAAGATGTAG
GCACCCGCATAATCGACCTGTATTTCGTGAGGGAGCGCAGCTCCAAGCGA
GAAACAAAACTAACCCAAATGCTTCTCTTTGTTAAGACCACGGTGTGGAA
GAATCTCTTTGGCAAAGAGGCGGAGAAACTGGAACATGCCAACGACGACG
AAAGGACATACTACATAATTGAAAAGGAACCGCTTGTCAACACATTCATA
AGCGTGCCAAAGGATAAGGGCTCGCTGAATTGCGCTAATTTCACCGCTGG
CATCGTGGAAGCTGTGCTCACGAACTGCGGATTTCCGTGCAAGGTCACCG
CCCACTGGCACAAGGGCACCACGTACATGGTCAAATTTGAGGACTTTGTC
ATCGCCCGCGACAAGCAGATGGAGGAGAAATAAATGGCATAGCTTCATTA
AAAAAAAAAAAAAAAAAAA

GH17639.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10153-RA 743 CG10153-RA 65..714 1..650 3250 100 Plus
CG10153.a 601 CG10153.a 286..599 337..650 1570 100 Plus
CG10153.a 601 CG10153.a 10..285 1..276 1380 100 Plus
CG12859-RA 597 CG12859-RA 529..597 650..582 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10644527..10644838 534..223 1545 99.7 Minus
chr2R 21145070 chr2R 10644892..10645115 224..1 1120 100 Minus
chr2R 21145070 chr2R 10644350..10644464 649..535 575 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:56:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14757241..14757552 534..223 1560 100 Minus
2R 25286936 2R 14757606..14757829 224..1 1120 100 Minus
2R 25286936 2R 14757063..14757178 650..535 580 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14758440..14758751 534..223 1560 100 Minus
2R 25260384 2R 14758805..14759028 224..1 1120 100 Minus
2R 25260384 2R 14758262..14758377 650..535 580 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:58:10 has no hits.

GH17639.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:58:59 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10644892..10645115 1..224 100   Minus
chr2R 10644350..10644464 535..649 100 <- Minus
chr2R 10644527..10644836 225..534 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:47:04 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 1..585 49..633 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:56 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 1..585 49..633 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:51:41 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 1..585 49..633 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:53 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 1..585 49..633 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:51:41 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
Trs31-RA 1..585 49..633 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:36:37 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:56 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:51:41 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 18..666 1..649 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:54 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
CG10153-RA 1..649 1..649 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:51:41 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
Trs31-RA 18..666 1..649 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:58:59 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14757064..14757178 535..649 100 <- Minus
2R 14757241..14757550 225..534 100 <- Minus
2R 14757606..14757829 1..224 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:58:59 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14757064..14757178 535..649 100 <- Minus
2R 14757241..14757550 225..534 100 <- Minus
2R 14757606..14757829 1..224 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:58:59 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14757064..14757178 535..649 100 <- Minus
2R 14757241..14757550 225..534 100 <- Minus
2R 14757606..14757829 1..224 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:51:41 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10644746..10645055 225..534 100 <- Minus
arm_2R 10645111..10645334 1..224 100   Minus
arm_2R 10644569..10644683 535..649 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:44 Download gff for GH17639.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14758805..14759028 1..224 100   Minus
2R 14758440..14758749 225..534 100 <- Minus
2R 14758263..14758377 535..649 100 <- Minus

GH17639.pep Sequence

Translation from 48 to 632

> GH17639.pep
MEKLEALKISSMRPRSNILDRPLSKGKTEVSQSIVALLFSEIVQYSQSRV
FTVPELQTRLHDLGQDVGTRIIDLYFVRERSSKRETKLTQMLLFVKTTVW
KNLFGKEAEKLEHANDDERTYYIIEKEPLVNTFISVPKDKGSLNCANFTA
GIVEAVLTNCGFPCKVTAHWHKGTTYMVKFEDFVIARDKQMEEK*

GH17639.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13515-PA 194 GF13515-PA 1..194 1..194 1035 99.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22402-PA 194 GG22402-PA 1..194 1..194 1039 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21147-PA 194 GH21147-PA 1..194 1..194 1012 97.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Trs31-PA 194 CG10153-PA 1..194 1..194 995 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18746-PA 194 GI18746-PA 1..194 1..194 1015 97.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10626-PA 194 GL10626-PA 1..194 1..194 1019 98.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10115-PA 194 GA10115-PA 1..194 1..194 1019 98.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20187-PA 194 GM20187-PA 1..194 1..194 1039 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25660-PA 204 GD25660-PA 1..183 1..183 981 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21768-PA 194 GJ21768-PA 1..194 1..194 1021 98.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19515-PA 194 GK19515-PA 1..194 1..194 1008 96.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12291-PA 194 GE12291-PA 1..194 1..194 1039 100 Plus

GH17639.hyp Sequence

Translation from 48 to 632

> GH17639.hyp
MEKLEALKISSMRPRSNILDRPLSKGKTEVSQSIVALLFSEIVQYSQSRV
FTVPELQTRLHDLGQDVGTRIIDLYFVRERSSKRETKLTQMLLFVKTTVW
KNLFGKEAEKLEHANDDERTYYIIEKEPLVNTFISVPKDKGSLNCANFTA
GIVEAVLTNCGFPCKVTAHWHKGTTYMVKFEDFVIARDKQMEEK*

GH17639.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Trs31-PA 194 CG10153-PA 1..194 1..194 995 100 Plus