Clone GH17679 Report

Search the DGRC for GH17679

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:176
Well:79
Vector:pOT2
Associated Gene/TranscriptOli-RA
Protein status:GH17679.pep: gold
Preliminary Size:1244
Sequenced Size:1086

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5545 2001-01-01 Release 2 assignment
CG5545 2003-01-01 Sim4 clustering to Release 3
CG5545 2003-02-27 Blastp of sequenced clone
Oli 2008-04-29 Release 5.5 accounting
Oli 2008-08-15 Release 5.9 accounting
Oli 2008-12-18 5.12 accounting

Clone Sequence Records

GH17679.complete Sequence

1086 bp (1086 high quality bases) assembled on 2003-02-27

GenBank Submission: BT004905

> GH17679.complete
TGCATCATAATAACTTTGATTTGCAAGGACTACCCTAAAAGATTACACAT
CCCTTCAACCTTTTTTTCACAGCTGGAAAAGTCCCATAAAATACAAAAAA
ATGGATCCCTCGAATCTTGCTTTTGGTTTTCCCGGTCTCCCCAACCACGG
ACACATGCCAATACCTCCTACAGCCAATATGCTTGGTGGCCAGCATCCAG
CACCCACCGCCAGCCCACCACAAAGCGTCCCCGGCCGTCGGACGCCACTT
GGATCGGTTGGTCTGGGTGGTTTCTATGCCCAGGGAATGGGCATGTCCCA
GCAGCCACCGACGGATGAGAACAAACCAGGGCCCAGTGCTCCGGAGAAGC
CATTGAGTCCCACGGCCGCCGCCATCGCAGCCATTGCCATCAGTGGTGGC
ACCACCACGGTGGCCGTGTCCAGTGGTGGCGCCAGCGGAAGTGGCTCCAA
CAGTGGCAAGCAGAAAAACCGCCAGGGAAAGACGGTAAGGCTGAACATAA
ATGCCCGGGAACGACGAAGGATGCACGATTTGAATGATGCCCTTGATGAG
CTGAGAAGTGTGATTCCCTATGCCCATTCGCCTTCTGTGCGAAAGCTGTC
GAAAATAGCCACCTTGCTGCTGGCTAAGAACTACATTCTGATGCAGCAAA
ATGCTCTCGAGGAGTTGAGAAGACTTTTGGCCTATATACAAAGCACCACG
GGAGCAGCGCCACTGGATTTGGGTGCATTTCCGGCGGCTGCCAAGTTGCA
GGCTCTTCTTCAAGGACCTCACAACGAACCACCGACTAGCAGCAGTTAAA
TAGGAGTGGGGGCCACCATAAACTATGGTTCAACTGATAAGCAATCCATT
AATGAGCAATACTTTTAAGTCAATTGGAAAGCAAATGCCAAATACTTGTG
TACTAGTCAGACGAAAGGAGGTTGATAAGGAGCCTCTTATCAGAGCAGCC
AAGTGAAAATCTGTTCAGTGATATTTATTTTTGTCATAAGCATTTCTTAT
TTATGCATTTACCCAATGTCAACCAATATGTGTAAGATGAATATTACCGA
ATAAAGTATTATTGAAGTAAAAAAAAAAAAAAAAAA

GH17679.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-RA 1251 Oli-RA 133..1205 1..1073 5350 99.9 Plus
Oli.a 1093 Oli.a 90..1091 72..1073 4995 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17588781..17589452 1..672 3360 100 Plus
chr2L 23010047 chr2L 17589511..17589908 671..1068 1990 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:56:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17590140..17590811 1..672 3360 100 Plus
2L 23513712 2L 17590870..17591272 671..1073 2000 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17590140..17590811 1..672 3360 100 Plus
2L 23513712 2L 17590870..17591272 671..1073 2000 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 06:17:57 has no hits.

GH17679.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:18:55 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17588781..17589452 1..672 100 -> Plus
chr2L 17589513..17589908 673..1068 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:47:09 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 1..699 101..799 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:39 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RC 1..699 101..799 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:44:33 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 1..699 101..799 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:34 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 1..699 101..799 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:57 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RD 1..699 101..799 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:58:37 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 634..1701 1..1068 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:39 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RC 1..1068 1..1068 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:44:33 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 739..1806 1..1068 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:34 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 634..1701 1..1068 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:57 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
Oli-RA 739..1806 1..1068 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:55 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17590140..17590811 1..672 100 -> Plus
2L 17590872..17591267 673..1068 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:55 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17590140..17590811 1..672 100 -> Plus
2L 17590872..17591267 673..1068 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:55 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17590140..17590811 1..672 100 -> Plus
2L 17590872..17591267 673..1068 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:44:33 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17590140..17590811 1..672 100 -> Plus
arm_2L 17590872..17591267 673..1068 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:08:26 Download gff for GH17679.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17590140..17590811 1..672 100 -> Plus
2L 17590872..17591267 673..1068 100   Plus

GH17679.hyp Sequence

Translation from 100 to 798

> GH17679.hyp
MDPSNLAFGFPGLPNHGHMPIPPTANMLGGQHPAPTASPPQSVPGRRTPL
GSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGG
TTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDE
LRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTT
GAAPLDLGAFPAAAKLQALLQGPHNEPPTSSS*

GH17679.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-PC 232 CG5545-PC 1..232 1..232 1194 100 Plus
Oli-PB 232 CG5545-PB 1..232 1..232 1194 100 Plus
Oli-PD 232 CG5545-PD 1..232 1..232 1194 100 Plus
Oli-PA 232 CG5545-PA 1..232 1..232 1194 100 Plus
dimm-PB 390 CG8667-PB 123..206 102..180 158 45.3 Plus

GH17679.pep Sequence

Translation from 100 to 798

> GH17679.pep
MDPSNLAFGFPGLPNHGHMPIPPTANMLGGQHPAPTASPPQSVPGRRTPL
GSVGLGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGG
TTTVAVSSGGASGSGSNSGKQKNRQGKTVRLNINARERRRMHDLNDALDE
LRSVIPYAHSPSVRKLSKIATLLLAKNYILMQQNALEELRRLLAYIQSTT
GAAPLDLGAFPAAAKLQALLQGPHNEPPTSSS*

GH17679.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14803-PA 234 GF14803-PA 1..233 1..232 1018 91.1 Plus
Dana\GF14327-PA 407 GF14327-PA 159..207 130..180 152 62.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21094-PA 232 GG21094-PA 1..232 1..232 1184 99.6 Plus
Dere\GG21298-PA 392 GG21298-PA 147..206 115..180 155 53 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11626-PA 241 GH11626-PA 1..240 1..232 946 88.4 Plus
Dgri\GH23918-PA 161 GH23918-PA 1..160 1..152 544 80.2 Plus
Dgri\GH13314-PA 421 GH13314-PA 117..195 100..180 156 44.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Oli-PC 232 CG5545-PC 1..232 1..232 1194 100 Plus
Oli-PB 232 CG5545-PB 1..232 1..232 1194 100 Plus
Oli-PD 232 CG5545-PD 1..232 1..232 1194 100 Plus
Oli-PA 232 CG5545-PA 1..232 1..232 1194 100 Plus
dimm-PB 390 CG8667-PB 123..206 102..180 158 45.3 Plus
dimm-PA 390 CG8667-PA 123..206 102..180 158 45.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17928-PA 241 GI17928-PA 1..239 1..232 962 87.6 Plus
Dmoj\GI12220-PA 413 GI12220-PA 138..197 115..180 151 53 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14513-PA 236 GL14513-PA 1..235 1..232 988 89.9 Plus
Dper\GL26661-PA 421 GL26661-PA 142..201 115..180 153 53 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18959-PA 236 GA18959-PA 1..235 1..232 988 89.9 Plus
Dpse\GA21247-PA 421 GA21247-PA 142..201 115..180 153 53 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17248-PA 232 GM17248-PA 1..232 1..232 1184 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24118-PA 232 GD24118-PA 1..232 1..232 1190 100 Plus
Dsim\GD24318-PA 386 GD24318-PA 145..204 115..180 153 53 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17701-PA 241 GJ17701-PA 1..239 1..232 896 87.1 Plus
Dvir\GJ17849-PA 418 GJ17849-PA 141..200 115..180 154 53 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18164-PA 246 GK18164-PA 1..244 1..232 936 86.6 Plus
Dwil\GK18738-PA 392 GK18738-PA 144..203 115..180 151 53 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12799-PA 232 GE12799-PA 1..232 1..232 1190 100 Plus
Dyak\GE12913-PA 393 GE12913-PA 147..206 115..180 154 53 Plus