Clone GH17740 Report

Search the DGRC for GH17740

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:177
Well:40
Vector:pOT2
Associated Gene/TranscriptCG10307-RA
Protein status:GH17740.pep: gold
Preliminary Size:1326
Sequenced Size:1241

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10307 2001-01-01 Release 2 assignment
CG10307 2003-01-01 Sim4 clustering to Release 3
CG10307 2003-02-27 Blastp of sequenced clone
CG10307 2008-04-29 Release 5.5 accounting
CG10307 2008-08-15 Release 5.9 accounting
CG10307 2008-12-18 5.12 accounting

Clone Sequence Records

GH17740.complete Sequence

1241 bp (1241 high quality bases) assembled on 2003-02-27

GenBank Submission: AY069156

> GH17740.complete
AAAAGACAAGGCCTGAAAACTAAGCTACTAGCGCCAAAAACAGAGTAGGT
TTTCCAAAGAGTGTGAAATAGTTTGGAACCCAAGACAACCAAATTCAAGT
GCTGCAGAAGTAAACACTTAATAAGGGCGACATGGAGAAGGTTTGTCAGT
TTTTCCGCAACAACTACGTGCTGGCCAATTGCGAGGATGCCATATACAAA
AAGGCATTCTCCCTGAATCTGTCCCACTACCAAATCTCCGACGTTCCGGG
CATCATAGAGAAGTGCGAGACGCTGATGAAGCTGTTCCTCAACCAAAACA
AGCTAACAAAGATTCCATCCTCCATTGGTAGTTTGATGCGACTTCAGGTC
CTCACGTTGGACTACAATAAACTGGACGAATTCCCGCTCTGCATCTGTCG
TTTGGTCCGGCTGAAGTTTCTCAACATCAGCTGCAATAACATTAGTAGTT
TGCCACCCGAACTGGGATACCTCACTCAGCTGGAGACGTTCTGGTGCAAT
AATACTGGGCTCCTGGAGCTGCCCAACGAAATTCGTAACTGTGAACACCT
CGAGACGCTGGGCGTACGGGGAAATCCCTTGAAGAAGTTGCCCGATGCCA
TAGGCGCTCTGTCCTCCCTGCGTTGGCTAACAGCCGAGGGCTGCGAACTC
AGCGAAGTGCCACTGACCATGGCGTTGCTGGGAAATTTGGTGCATCTGAA
TCTTAAGGGGAATCGATTGCGACGGCTGCCCAGGATGCTGATGGCCATGC
AGAAGCTGCGGTTTGCTTTTCTCAACGAAAATTGTATTGACGAGATGCCC
ACGCGGTCACAACTGGAGGAGTTGCGGACTCTTCACATGCTCAACCTGTC
CAAGAATCCCATCAGCCTGCACCGCGATCTACAGCTAATGGCTTTGCGCC
AGACGAACCTTTATGTGGAGCTGCCGTCAGATCCCGCCAATATTTGCGAT
GGTCTCGCCAGTCGAGCTAGCCTCAACGCCCAGGAACAGCAGGAGGATCA
GGCGCGAGGAGCAGGACAGGATCTAGACTCCTCCGACTGGGCGAACAGCG
TGCGGACCAGCGAACTGGACACAACGGACGAGAGTGCGCTGGAGAACAAC
ATCGAGGATCTGAGTGTCATGCTGCCGGAAATGTCGCGCTTTGTCACCAC
CTTTTGAATGCATTAATCTGTGTCAACGAGGTCTGATATTATGTAGCACA
CATAAATCTGTGGTTTATTCTCTAAAAAAAAAAAAAAAAAA

GH17740.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG10307-RA 1356 CG10307-RA 134..1356 1..1223 6115 100 Plus
Tim10-RB 687 Tim10-RB 648..687 1224..1185 200 100 Minus
Tim10-RA 690 Tim10-RA 651..690 1224..1185 200 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17575767..17576353 310..896 2860 99.1 Plus
chr2R 21145070 chr2R 17576411..17576738 896..1223 1595 99.1 Plus
chr2R 21145070 chr2R 17575397..17575707 1..311 1480 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:57:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21689282..21689868 310..896 2935 100 Plus
2R 25286936 2R 21689926..21690254 896..1224 1645 100 Plus
2R 25286936 2R 21688912..21689222 1..311 1555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21690481..21691067 310..896 2935 100 Plus
2R 25260384 2R 21691125..21691453 896..1224 1645 100 Plus
2R 25260384 2R 21690111..21690421 1..311 1555 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:12:55 has no hits.

GH17740.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:14:04 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17575397..17575707 1..311 98 -> Plus
chr2R 17575769..17576353 312..896 99 -> Plus
chr2R 17576412..17576738 897..1223 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:47:13 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1026 132..1157 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:55 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1026 132..1157 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:12 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1026 132..1157 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:39:17 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1026 132..1157 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:22:31 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1026 132..1157 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:59 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1223 1..1223 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:55 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1223 1..1223 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:12 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1223 1..1223 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:39:17 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 1..1223 1..1223 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:22:31 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
CG10307-RA 140..1362 1..1223 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:04 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21688912..21689222 1..311 100 -> Plus
2R 21689284..21689868 312..896 100 -> Plus
2R 21689927..21690253 897..1223 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:04 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21688912..21689222 1..311 100 -> Plus
2R 21689284..21689868 312..896 100 -> Plus
2R 21689927..21690253 897..1223 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:14:04 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21688912..21689222 1..311 100 -> Plus
2R 21689284..21689868 312..896 100 -> Plus
2R 21689927..21690253 897..1223 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:12 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17576417..17576727 1..311 100 -> Plus
arm_2R 17576789..17577373 312..896 100 -> Plus
arm_2R 17577432..17577758 897..1223 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:38 Download gff for GH17740.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690111..21690421 1..311 100 -> Plus
2R 21690483..21691067 312..896 100 -> Plus
2R 21691126..21691452 897..1223 100   Plus

GH17740.hyp Sequence

Translation from 131 to 1156

> GH17740.hyp
MEKVCQFFRNNYVLANCEDAIYKKAFSLNLSHYQISDVPGIIEKCETLMK
LFLNQNKLTKIPSSIGSLMRLQVLTLDYNKLDEFPLCICRLVRLKFLNIS
CNNISSLPPELGYLTQLETFWCNNTGLLELPNEIRNCEHLETLGVRGNPL
KKLPDAIGALSSLRWLTAEGCELSEVPLTMALLGNLVHLNLKGNRLRRLP
RMLMAMQKLRFAFLNENCIDEMPTRSQLEELRTLHMLNLSKNPISLHRDL
QLMALRQTNLYVELPSDPANICDGLASRASLNAQEQQEDQARGAGQDLDS
SDWANSVRTSELDTTDESALENNIEDLSVMLPEMSRFVTTF*

GH17740.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10307-PB 341 CG10307-PB 1..341 1..341 1762 100 Plus
CG10307-PA 341 CG10307-PA 1..341 1..341 1762 100 Plus
scrib-PC 1247 CG43398-PC 112..357 29..270 263 32.5 Plus
scrib-PI 1711 CG43398-PI 112..357 29..270 263 32.5 Plus
scrib-PP 1729 CG43398-PP 112..357 29..270 263 32.5 Plus
scrib-PC 1247 CG43398-PC 65..284 28..249 234 28.8 Plus
scrib-PI 1711 CG43398-PI 65..284 28..249 234 28.8 Plus
scrib-PC 1247 CG43398-PC 42..254 28..242 226 30.7 Plus
scrib-PI 1711 CG43398-PI 42..254 28..242 226 30.7 Plus
scrib-PC 1247 CG43398-PC 180..352 28..200 221 31.2 Plus
scrib-PI 1711 CG43398-PI 180..352 28..200 221 31.2 Plus
scrib-PC 1247 CG43398-PC 134..348 28..244 217 30.4 Plus
scrib-PI 1711 CG43398-PI 134..348 28..244 217 30.4 Plus
scrib-PC 1247 CG43398-PC 156..433 27..300 210 27.5 Plus
scrib-PI 1711 CG43398-PI 156..433 27..300 210 27.5 Plus
scrib-PC 1247 CG43398-PC 25..210 58..244 197 29.8 Plus
scrib-PC 1247 CG43398-PC 216..384 18..192 197 32 Plus
scrib-PI 1711 CG43398-PI 25..210 58..244 197 29.8 Plus
scrib-PI 1711 CG43398-PI 216..384 18..192 197 32 Plus

GH17740.pep Sequence

Translation from 131 to 1156

> GH17740.pep
MEKVCQFFRNNYVLANCEDAIYKKAFSLNLSHYQISDVPGIIEKCETLMK
LFLNQNKLTKIPSSIGSLMRLQVLTLDYNKLDEFPLCICRLVRLKFLNIS
CNNISSLPPELGYLTQLETFWCNNTGLLELPNEIRNCEHLETLGVRGNPL
KKLPDAIGALSSLRWLTAEGCELSEVPLTMALLGNLVHLNLKGNRLRRLP
RMLMAMQKLRFAFLNENCIDEMPTRSQLEELRTLHMLNLSKNPISLHRDL
QLMALRQTNLYVELPSDPANICDGLASRASLNAQEQQEDQARGAGQDLDS
SDWANSVRTSELDTTDESALENNIEDLSVMLPEMSRFVTTF*

GH17740.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13262-PA 341 GF13262-PA 1..341 1..341 1571 86.2 Plus
Dana\GF12306-PA 860 GF12306-PA 184..379 28..223 247 31.1 Plus
Dana\GF12306-PA 860 GF12306-PA 110..353 23..245 238 30.1 Plus
Dana\GF16442-PA 1847 GF16442-PA 112..323 29..242 232 34.1 Plus
Dana\GF18150-PA 782 GF18150-PA 275..551 28..295 218 30.5 Plus
Dana\GF16883-PA 641 GF16883-PA 412..614 20..245 214 28.5 Plus
Dana\GF16442-PA 1847 GF16442-PA 65..277 28..242 211 29.3 Plus
Dana\GF16442-PA 1847 GF16442-PA 48..254 34..242 211 30.6 Plus
Dana\GF16883-PA 641 GF16883-PA 153..427 13..244 207 28 Plus
Dana\GF12306-PA 860 GF12306-PA 46..287 28..265 203 29.9 Plus
Dana\GF16883-PA 641 GF16883-PA 467..617 28..177 198 35.8 Plus
Dana\GF16442-PA 1847 GF16442-PA 180..355 28..203 197 31.2 Plus
Dana\GF16442-PA 1847 GF16442-PA 226..384 28..192 186 33.3 Plus
Dana\GF16442-PA 1847 GF16442-PA 25..208 58..242 182 30.1 Plus
Dana\GF18150-PA 782 GF18150-PA 249..439 48..238 179 34 Plus
Dana\GF12306-PA 860 GF12306-PA 31..214 36..244 178 28.7 Plus
Dana\GF16442-PA 1847 GF16442-PA 156..386 27..255 174 29.5 Plus
Dana\GF16883-PA 641 GF16883-PA 492..632 30..166 174 35.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22132-PA 341 GG22132-PA 1..341 1..341 1687 93 Plus
Dere\GG11485-PA 1855 GG11485-PA 112..323 29..242 238 34.1 Plus
Dere\GG20492-PA 849 GG20492-PA 183..379 28..224 237 29.4 Plus
Dere\GG20492-PA 849 GG20492-PA 109..352 23..245 233 29.3 Plus
Dere\GG11485-PA 1855 GG11485-PA 65..277 28..242 212 29.3 Plus
Dere\GG16778-PA 644 GG16778-PA 156..430 13..244 212 28.3 Plus
Dere\GG16778-PA 644 GG16778-PA 415..617 20..245 212 28.5 Plus
Dere\GG11485-PA 1855 GG11485-PA 48..254 34..242 210 30.6 Plus
Dere\GG17029-PA 873 GG17029-PA 259..560 28..326 209 27.9 Plus
Dere\GG20492-PA 849 GG20492-PA 45..286 28..265 206 30.3 Plus
Dere\GG11485-PA 1855 GG11485-PA 180..355 28..203 204 31.8 Plus
Dere\GG16778-PA 644 GG16778-PA 470..620 28..177 196 35.8 Plus
Dere\GG20492-PA 849 GG20492-PA 13..245 42..270 190 30.6 Plus
Dere\GG11485-PA 1855 GG11485-PA 25..208 58..242 183 30.1 Plus
Dere\GG11485-PA 1855 GG11485-PA 156..386 27..255 177 29.5 Plus
Dere\GG17029-PA 873 GG17029-PA 233..423 48..238 177 34 Plus
Dere\GG16778-PA 644 GG16778-PA 495..635 30..166 173 35.5 Plus
Dere\GG11485-PA 1855 GG11485-PA 205..391 30..217 151 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:16:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23114-PA 340 GH23114-PA 1..340 1..341 1119 63.9 Plus
Dgri\GH21104-PA 910 GH21104-PA 110..333 23..223 247 31.7 Plus
Dgri\GH21104-PA 910 GH21104-PA 184..380 28..224 242 29.9 Plus
Dgri\GH18723-PA 1864 GH18723-PA 112..323 29..242 239 34.1 Plus
Dgri\GH18723-PA 1864 GH18723-PA 65..277 28..242 214 29.8 Plus
Dgri\GH21104-PA 910 GH21104-PA 46..258 28..242 213 31.6 Plus
Dgri\GH18723-PA 1864 GH18723-PA 48..254 34..242 210 30.6 Plus
Dgri\GH14049-PA 744 GH14049-PA 239..455 28..246 208 31.1 Plus
Dgri\GH17496-PA 622 GH17496-PA 134..408 13..244 205 28 Plus
Dgri\GH17496-PA 622 GH17496-PA 393..595 20..245 199 27.2 Plus
Dgri\GH14049-PA 744 GH14049-PA 216..403 51..238 196 34.6 Plus
Dgri\GH18723-PA 1864 GH18723-PA 180..352 28..200 192 30.1 Plus
Dgri\GH17496-PA 622 GH17496-PA 448..598 28..177 191 34.4 Plus
Dgri\GH18723-PA 1864 GH18723-PA 156..386 27..255 187 29.9 Plus
Dgri\GH18723-PA 1864 GH18723-PA 25..208 58..242 183 30.1 Plus
Dgri\GH14049-PA 744 GH14049-PA 285..484 28..204 178 26.5 Plus
Dgri\GH17496-PA 622 GH17496-PA 473..613 30..166 171 34.8 Plus
Dgri\GH21104-PA 910 GH21104-PA 43..214 71..244 170 31 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG10307-PB 341 CG10307-PB 1..341 1..341 1762 100 Plus
CG10307-PA 341 CG10307-PA 1..341 1..341 1762 100 Plus
scrib-PC 1247 CG43398-PC 112..357 29..270 263 32.5 Plus
scrib-PI 1711 CG43398-PI 112..357 29..270 263 32.5 Plus
scrib-PP 1729 CG43398-PP 112..357 29..270 263 32.5 Plus
scrib-PB 1756 CG43398-PB 112..357 29..270 263 32.5 Plus
scrib-PA 1756 CG43398-PA 112..357 29..270 263 32.5 Plus
scrib-PU 1766 CG43398-PU 112..357 29..270 263 32.5 Plus
scrib-PD 1851 CG43398-PD 112..357 29..270 263 32.5 Plus
scrib-PH 1939 CG43398-PH 112..357 29..270 263 32.5 Plus
scrib-PR 1951 CG43398-PR 112..357 29..270 263 32.5 Plus
scrib-PK 2331 CG43398-PK 112..357 29..270 263 32.5 Plus
scrib-PJ 2426 CG43398-PJ 112..357 29..270 263 32.5 Plus
scrib-PT 2444 CG43398-PT 112..357 29..270 263 32.5 Plus
scrib-PM 2490 CG43398-PM 112..357 29..270 263 32.5 Plus
scrib-PO 2515 CG43398-PO 112..357 29..270 263 32.5 Plus
scrib-PN 2554 CG43398-PN 112..357 29..270 263 32.5 Plus
scrib-PQ 2577 CG43398-PQ 112..357 29..270 263 32.5 Plus
scrib-PL 2585 CG43398-PL 112..357 29..270 263 32.5 Plus
Lap1-PB 849 CG10255-PB 183..438 28..290 260 26.2 Plus
Lap1-PA 849 CG10255-PA 183..438 28..290 260 26.2 Plus
Lap1-PB 849 CG10255-PB 94..352 10..245 257 28.7 Plus
Lap1-PA 849 CG10255-PA 94..352 10..245 257 28.7 Plus
Sur-8-PF 641 CG5407-PF 412..614 20..245 238 28.5 Plus
Sur-8-PB 641 CG5407-PB 412..614 20..245 238 28.5 Plus
Sur-8-PA 641 CG5407-PA 412..614 20..245 238 28.5 Plus
Sur-8-PE 694 CG5407-PE 412..614 20..245 238 28.5 Plus
scrib-PC 1247 CG43398-PC 65..284 28..249 234 28.8 Plus
scrib-PI 1711 CG43398-PI 65..284 28..249 234 28.8 Plus
scrib-PP 1729 CG43398-PP 65..284 28..249 234 28.8 Plus
scrib-PB 1756 CG43398-PB 65..284 28..249 234 28.8 Plus
scrib-PA 1756 CG43398-PA 65..284 28..249 234 28.8 Plus
scrib-PU 1766 CG43398-PU 65..284 28..249 234 28.8 Plus
scrib-PD 1851 CG43398-PD 65..284 28..249 234 28.8 Plus
scrib-PH 1939 CG43398-PH 65..284 28..249 234 28.8 Plus
scrib-PR 1951 CG43398-PR 65..284 28..249 234 28.8 Plus
scrib-PK 2331 CG43398-PK 65..284 28..249 234 28.8 Plus
scrib-PJ 2426 CG43398-PJ 65..284 28..249 234 28.8 Plus
scrib-PT 2444 CG43398-PT 65..284 28..249 234 28.8 Plus
scrib-PM 2490 CG43398-PM 65..284 28..249 234 28.8 Plus
scrib-PO 2515 CG43398-PO 65..284 28..249 234 28.8 Plus
scrib-PN 2554 CG43398-PN 65..284 28..249 234 28.8 Plus
scrib-PQ 2577 CG43398-PQ 65..284 28..249 234 28.8 Plus
scrib-PL 2585 CG43398-PL 65..284 28..249 234 28.8 Plus
Sur-8-PF 641 CG5407-PF 210..427 27..244 234 31.1 Plus
Sur-8-PB 641 CG5407-PB 210..427 27..244 234 31.1 Plus
Sur-8-PA 641 CG5407-PA 210..427 27..244 234 31.1 Plus
Sur-8-PE 694 CG5407-PE 210..427 27..244 234 31.1 Plus
Sur-8-PF 641 CG5407-PF 154..390 14..255 233 27.3 Plus
Sur-8-PB 641 CG5407-PB 154..390 14..255 233 27.3 Plus
Sur-8-PA 641 CG5407-PA 154..390 14..255 233 27.3 Plus
Sur-8-PE 694 CG5407-PE 154..390 14..255 233 27.3 Plus
Lap1-PB 849 CG10255-PB 45..286 28..265 230 30.3 Plus
Lap1-PA 849 CG10255-PA 45..286 28..265 230 30.3 Plus
scrib-PC 1247 CG43398-PC 42..254 28..242 226 30.7 Plus
scrib-PI 1711 CG43398-PI 42..254 28..242 226 30.7 Plus
scrib-PP 1729 CG43398-PP 42..254 28..242 226 30.7 Plus
scrib-PB 1756 CG43398-PB 42..254 28..242 226 30.7 Plus
scrib-PA 1756 CG43398-PA 42..254 28..242 226 30.7 Plus
scrib-PU 1766 CG43398-PU 42..254 28..242 226 30.7 Plus
scrib-PD 1851 CG43398-PD 42..254 28..242 226 30.7 Plus
scrib-PH 1939 CG43398-PH 42..254 28..242 226 30.7 Plus
scrib-PR 1951 CG43398-PR 42..254 28..242 226 30.7 Plus
scrib-PK 2331 CG43398-PK 42..254 28..242 226 30.7 Plus
scrib-PJ 2426 CG43398-PJ 42..254 28..242 226 30.7 Plus
scrib-PT 2444 CG43398-PT 42..254 28..242 226 30.7 Plus
scrib-PM 2490 CG43398-PM 42..254 28..242 226 30.7 Plus
scrib-PO 2515 CG43398-PO 42..254 28..242 226 30.7 Plus
scrib-PN 2554 CG43398-PN 42..254 28..242 226 30.7 Plus
scrib-PQ 2577 CG43398-PQ 42..254 28..242 226 30.7 Plus
scrib-PL 2585 CG43398-PL 42..254 28..242 226 30.7 Plus
scrib-PC 1247 CG43398-PC 180..352 28..200 221 31.2 Plus
scrib-PI 1711 CG43398-PI 180..352 28..200 221 31.2 Plus
scrib-PP 1729 CG43398-PP 180..352 28..200 221 31.2 Plus
scrib-PB 1756 CG43398-PB 180..352 28..200 221 31.2 Plus
scrib-PA 1756 CG43398-PA 180..352 28..200 221 31.2 Plus
scrib-PU 1766 CG43398-PU 180..352 28..200 221 31.2 Plus
scrib-PD 1851 CG43398-PD 180..352 28..200 221 31.2 Plus
scrib-PH 1939 CG43398-PH 180..352 28..200 221 31.2 Plus
scrib-PR 1951 CG43398-PR 180..352 28..200 221 31.2 Plus
scrib-PK 2331 CG43398-PK 180..352 28..200 221 31.2 Plus
scrib-PJ 2426 CG43398-PJ 180..352 28..200 221 31.2 Plus
scrib-PT 2444 CG43398-PT 180..352 28..200 221 31.2 Plus
scrib-PM 2490 CG43398-PM 180..352 28..200 221 31.2 Plus
scrib-PO 2515 CG43398-PO 180..352 28..200 221 31.2 Plus
scrib-PN 2554 CG43398-PN 180..352 28..200 221 31.2 Plus
scrib-PQ 2577 CG43398-PQ 180..352 28..200 221 31.2 Plus
scrib-PL 2585 CG43398-PL 180..352 28..200 221 31.2 Plus
fliI-PA 1256 CG1484-PA 104..361 27..275 218 30.1 Plus
scrib-PC 1247 CG43398-PC 134..348 28..244 217 30.4 Plus
scrib-PI 1711 CG43398-PI 134..348 28..244 217 30.4 Plus
scrib-PP 1729 CG43398-PP 134..348 28..244 217 30.4 Plus
scrib-PB 1756 CG43398-PB 134..348 28..244 217 30.4 Plus
scrib-PA 1756 CG43398-PA 134..348 28..244 217 30.4 Plus
scrib-PU 1766 CG43398-PU 134..348 28..244 217 30.4 Plus
scrib-PD 1851 CG43398-PD 134..348 28..244 217 30.4 Plus
scrib-PH 1939 CG43398-PH 134..348 28..244 217 30.4 Plus
scrib-PR 1951 CG43398-PR 134..348 28..244 217 30.4 Plus
scrib-PK 2331 CG43398-PK 134..348 28..244 217 30.4 Plus
scrib-PJ 2426 CG43398-PJ 134..348 28..244 217 30.4 Plus
scrib-PT 2444 CG43398-PT 134..348 28..244 217 30.4 Plus
scrib-PM 2490 CG43398-PM 134..348 28..244 217 30.4 Plus
scrib-PO 2515 CG43398-PO 134..348 28..244 217 30.4 Plus
scrib-PN 2554 CG43398-PN 134..348 28..244 217 30.4 Plus
scrib-PQ 2577 CG43398-PQ 134..348 28..244 217 30.4 Plus
scrib-PL 2585 CG43398-PL 134..348 28..244 217 30.4 Plus
f-cup-PD 474 CG9611-PD 39..279 27..246 217 29.3 Plus
f-cup-PI 522 CG9611-PI 87..327 27..246 217 29.3 Plus
f-cup-PC 522 CG9611-PC 87..327 27..246 217 29.3 Plus
f-cup-PH 571 CG9611-PH 117..357 27..246 217 29.3 Plus
f-cup-PE 620 CG9611-PE 87..327 27..246 217 29.3 Plus
f-cup-PB 650 CG9611-PB 117..357 27..246 217 29.3 Plus
f-cup-PA 693 CG9611-PA 160..400 27..246 217 29.3 Plus
f-cup-PG 759 CG9611-PG 117..357 27..246 217 29.3 Plus
f-cup-PF 802 CG9611-PF 160..400 27..246 217 29.3 Plus
Lap1-PB 849 CG10255-PB 17..245 46..270 216 31.2 Plus
Lap1-PA 849 CG10255-PA 17..245 46..270 216 31.2 Plus
Sur-8-PF 641 CG5407-PF 467..617 28..177 213 35.1 Plus
Sur-8-PB 641 CG5407-PB 467..617 28..177 213 35.1 Plus
Sur-8-PA 641 CG5407-PA 467..617 28..177 213 35.1 Plus
Sur-8-PE 694 CG5407-PE 467..617 28..177 213 35.1 Plus
scrib-PC 1247 CG43398-PC 156..433 27..300 210 27.5 Plus
scrib-PI 1711 CG43398-PI 156..433 27..300 210 27.5 Plus
scrib-PB 1756 CG43398-PB 156..433 27..300 210 27.5 Plus
scrib-PA 1756 CG43398-PA 156..433 27..300 210 27.5 Plus
scrib-PU 1766 CG43398-PU 156..433 27..300 210 27.5 Plus
scrib-PD 1851 CG43398-PD 156..433 27..300 210 27.5 Plus
scrib-PH 1939 CG43398-PH 156..433 27..300 210 27.5 Plus
scrib-PR 1951 CG43398-PR 156..433 27..300 210 27.5 Plus
scrib-PK 2331 CG43398-PK 156..433 27..300 210 27.5 Plus
scrib-PJ 2426 CG43398-PJ 156..433 27..300 210 27.5 Plus
scrib-PT 2444 CG43398-PT 156..433 27..300 210 27.5 Plus
scrib-PM 2490 CG43398-PM 156..433 27..300 210 27.5 Plus
scrib-PL 2585 CG43398-PL 156..433 27..300 210 27.5 Plus
scrib-PP 1729 CG43398-PP 156..371 27..244 209 28.4 Plus
scrib-PO 2515 CG43398-PO 156..371 27..244 209 28.4 Plus
scrib-PN 2554 CG43398-PN 156..371 27..244 209 28.4 Plus
scrib-PQ 2577 CG43398-PQ 156..371 27..244 209 28.4 Plus
f-cup-PD 474 CG9611-PD 37..260 48..267 202 32.4 Plus
f-cup-PI 522 CG9611-PI 85..308 48..267 202 32.4 Plus
f-cup-PC 522 CG9611-PC 85..308 48..267 202 32.4 Plus
f-cup-PH 571 CG9611-PH 115..338 48..267 202 32.4 Plus
f-cup-PE 620 CG9611-PE 85..308 48..267 202 32.4 Plus
f-cup-PB 650 CG9611-PB 115..338 48..267 202 32.4 Plus
f-cup-PA 693 CG9611-PA 158..381 48..267 202 32.4 Plus
f-cup-PG 759 CG9611-PG 115..338 48..267 202 32.4 Plus
f-cup-PF 802 CG9611-PF 158..381 48..267 202 32.4 Plus
scrib-PC 1247 CG43398-PC 25..210 58..244 197 29.8 Plus
scrib-PC 1247 CG43398-PC 216..384 18..192 197 32 Plus
scrib-PI 1711 CG43398-PI 25..210 58..244 197 29.8 Plus
scrib-PI 1711 CG43398-PI 216..384 18..192 197 32 Plus
scrib-PP 1729 CG43398-PP 25..210 58..244 197 29.8 Plus
scrib-PP 1729 CG43398-PP 216..384 18..192 197 32 Plus
scrib-PB 1756 CG43398-PB 25..210 58..244 197 29.8 Plus
scrib-PB 1756 CG43398-PB 216..384 18..192 197 32 Plus
scrib-PA 1756 CG43398-PA 25..210 58..244 197 29.8 Plus
scrib-PA 1756 CG43398-PA 216..384 18..192 197 32 Plus
scrib-PU 1766 CG43398-PU 25..210 58..244 197 29.8 Plus
scrib-PU 1766 CG43398-PU 216..384 18..192 197 32 Plus
scrib-PD 1851 CG43398-PD 25..210 58..244 197 29.8 Plus
scrib-PD 1851 CG43398-PD 216..384 18..192 197 32 Plus
scrib-PH 1939 CG43398-PH 25..210 58..244 197 29.8 Plus
scrib-PH 1939 CG43398-PH 216..384 18..192 197 32 Plus
scrib-PR 1951 CG43398-PR 25..210 58..244 197 29.8 Plus
scrib-PR 1951 CG43398-PR 216..384 18..192 197 32 Plus
scrib-PK 2331 CG43398-PK 25..210 58..244 197 29.8 Plus
scrib-PK 2331 CG43398-PK 216..384 18..192 197 32 Plus
scrib-PJ 2426 CG43398-PJ 25..210 58..244 197 29.8 Plus
scrib-PJ 2426 CG43398-PJ 216..384 18..192 197 32 Plus
scrib-PT 2444 CG43398-PT 25..210 58..244 197 29.8 Plus
scrib-PT 2444 CG43398-PT 216..384 18..192 197 32 Plus
scrib-PM 2490 CG43398-PM 25..210 58..244 197 29.8 Plus
scrib-PM 2490 CG43398-PM 216..384 18..192 197 32 Plus
scrib-PO 2515 CG43398-PO 25..210 58..244 197 29.8 Plus
scrib-PO 2515 CG43398-PO 216..384 18..192 197 32 Plus
scrib-PN 2554 CG43398-PN 25..210 58..244 197 29.8 Plus
scrib-PN 2554 CG43398-PN 216..384 18..192 197 32 Plus
scrib-PQ 2577 CG43398-PQ 25..210 58..244 197 29.8 Plus
scrib-PQ 2577 CG43398-PQ 216..384 18..192 197 32 Plus
scrib-PL 2585 CG43398-PL 25..210 58..244 197 29.8 Plus
scrib-PL 2585 CG43398-PL 216..384 18..192 197 32 Plus
f-cup-PD 474 CG9611-PD 81..364 23..326 193 26.3 Plus
f-cup-PI 522 CG9611-PI 129..412 23..326 193 26.3 Plus
f-cup-PC 522 CG9611-PC 129..412 23..326 193 26.3 Plus
f-cup-PH 571 CG9611-PH 159..442 23..326 193 26.3 Plus
f-cup-PE 620 CG9611-PE 129..412 23..326 193 26.3 Plus
f-cup-PB 650 CG9611-PB 159..442 23..326 193 26.3 Plus
f-cup-PA 693 CG9611-PA 202..485 23..326 193 26.3 Plus
f-cup-PG 759 CG9611-PG 159..442 23..326 193 26.3 Plus
f-cup-PF 802 CG9611-PF 202..485 23..326 193 26.3 Plus
ics-PC 283 CG9031-PC 42..206 37..200 193 30.1 Plus
ics-PB 283 CG9031-PB 42..206 37..200 193 30.1 Plus
ics-PA 283 CG9031-PA 42..206 37..200 193 30.1 Plus
fliI-PA 1256 CG1484-PA 52..277 23..244 190 31.1 Plus
Sur-8-PF 641 CG5407-PF 490..632 28..166 188 35.7 Plus
Sur-8-PB 641 CG5407-PB 490..632 28..166 188 35.7 Plus
Sur-8-PA 641 CG5407-PA 490..632 28..166 188 35.7 Plus
Sur-8-PE 694 CG5407-PE 490..632 28..166 188 35.7 Plus
fliI-PA 1256 CG1484-PA 174..402 27..252 184 29.5 Plus
scrib-PP 1729 CG43398-PP 205..391 30..217 183 30.3 Plus
scrib-PO 2515 CG43398-PO 205..391 30..217 183 30.3 Plus
scrib-PN 2554 CG43398-PN 205..391 30..217 183 30.3 Plus
scrib-PQ 2577 CG43398-PQ 205..391 30..217 183 30.3 Plus
CG11099-PB 378 CG11099-PB 1..168 69..234 183 32.7 Plus
CG11099-PA 378 CG11099-PA 1..168 69..234 183 32.7 Plus
fliI-PA 1256 CG1484-PA 10..194 76..256 180 29.4 Plus
CG11099-PB 378 CG11099-PB 6..191 28..189 178 28 Plus
CG11099-PA 378 CG11099-PA 6..191 28..189 178 28 Plus
CG3040-PA 238 CG3040-PA 6..187 41..219 177 29 Plus
ics-PC 283 CG9031-PC 55..212 28..183 171 30.4 Plus
ics-PB 283 CG9031-PB 55..212 28..183 171 30.4 Plus
ics-PA 283 CG9031-PA 55..212 28..183 171 30.4 Plus
fliI-PA 1256 CG1484-PA 22..202 62..240 170 29.1 Plus
Lrch-PA 809 CG6860-PA 105..303 29..226 170 30.8 Plus
Lrch-PC 1079 CG6860-PC 105..303 29..226 170 30.8 Plus
Lrch-PB 1135 CG6860-PB 105..303 29..226 170 30.8 Plus
ics-PC 283 CG9031-PC 78..215 28..163 168 31.9 Plus
ics-PB 283 CG9031-PB 78..215 28..163 168 31.9 Plus
ics-PA 283 CG9031-PA 78..215 28..163 168 31.9 Plus
CG32687-PB 377 CG32687-PB 29..274 28..260 166 24.7 Plus
CG32687-PA 377 CG32687-PA 29..274 28..260 166 24.7 Plus
CG32687-PB 377 CG32687-PB 35..257 14..217 165 25.4 Plus
CG32687-PA 377 CG32687-PA 35..257 14..217 165 25.4 Plus
fliI-PA 1256 CG1484-PA 22..231 39..244 164 26.6 Plus
CG3040-PA 238 CG3040-PA 66..188 28..151 159 30.2 Plus
CG3494-PB 240 CG3494-PB 40..225 28..206 159 28.5 Plus
CG3494-PA 240 CG3494-PA 40..225 28..206 159 28.5 Plus
fliI-PA 1256 CG1484-PA 263..375 21..131 158 36.3 Plus
Lrch-PA 809 CG6860-PA 57..272 30..245 158 29.5 Plus
Lrch-PC 1079 CG6860-PC 57..272 30..245 158 29.5 Plus
Lrch-PB 1135 CG6860-PB 57..272 30..245 158 29.5 Plus
twin-PC 567 CG31137-PC 10..157 22..152 156 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18937-PA 335 GI18937-PA 1..335 1..341 1166 66.4 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 112..357 29..270 265 32.5 Plus
Dmoj\GI18706-PA 906 GI18706-PA 110..333 23..223 246 31.7 Plus
Dmoj\GI18706-PA 906 GI18706-PA 184..380 28..224 239 29.4 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 65..312 28..271 235 28.7 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 42..254 28..242 221 30.2 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 156..386 27..255 214 29.9 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 134..348 28..244 210 30.4 Plus
Dmoj\GI24424-PA 694 GI24424-PA 151..467 16..304 210 28 Plus
Dmoj\GI22824-PA 471 GI22824-PA 128..377 16..265 208 29.2 Plus
Dmoj\GI18706-PA 906 GI18706-PA 46..258 28..242 205 31.2 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 216..385 18..193 198 32.4 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 203..391 28..217 194 31.6 Plus
Dmoj\GI22874-PA 1865 GI22874-PA 25..191 58..223 188 29.3 Plus
Dmoj\GI22824-PA 471 GI22824-PA 298..447 27..177 188 34.2 Plus
Dmoj\GI22824-PA 471 GI22824-PA 183..418 27..243 187 29 Plus
Dmoj\GI18706-PA 906 GI18706-PA 43..207 71..234 168 31.5 Plus
Dmoj\GI22824-PA 471 GI22824-PA 311..462 19..166 168 34.2 Plus
Dmoj\GI24424-PA 694 GI24424-PA 492..679 22..207 162 29.3 Plus
Dmoj\GI22824-PA 471 GI22824-PA 113..337 47..271 156 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10803-PA 103 GL10803-PA 1..103 236..341 303 57.5 Plus
Dper\GL10804-PA 83 GL10804-PA 1..60 1..60 248 78.3 Plus
Dper\GL23097-PA 1247 GL23097-PA 158..369 29..242 234 34.1 Plus
Dper\GL23942-PA 333 GL23942-PA 23..222 27..225 213 32 Plus
Dper\GL23097-PA 1247 GL23097-PA 226..398 28..200 202 31.2 Plus
Dper\GL24452-PA 655 GL24452-PA 163..398 37..250 198 31.2 Plus
Dper\GL23097-PA 1247 GL23097-PA 202..432 27..255 181 29.5 Plus
Dper\GL23097-PA 1247 GL23097-PA 141..323 58..242 176 28.6 Plus
Dper\GL24452-PA 655 GL24452-PA 183..399 3..204 176 25.3 Plus
Dper\GL24452-PA 655 GL24452-PA 119..322 18..245 176 30 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10235-PA 340 GA10235-PA 1..340 1..341 1260 70 Plus
Dpse\GA10197-PA 848 GA10197-PA 183..379 28..224 243 30.5 Plus
Dpse\GA10197-PA 848 GA10197-PA 94..352 10..245 237 29.5 Plus
Dpse\GA18897-PA 1889 GA18897-PA 112..323 29..242 233 34.1 Plus
Dpse\GA27118-PA 629 GA27118-PA 141..415 13..244 217 28.7 Plus
Dpse\GA18897-PA 1889 GA18897-PA 65..277 28..242 212 29.3 Plus
Dpse\GA18897-PA 1889 GA18897-PA 48..254 34..242 208 30.6 Plus
Dpse\GA27118-PA 629 GA27118-PA 400..602 20..245 205 28.1 Plus
Dpse\GA10197-PA 848 GA10197-PA 45..286 28..265 202 30.3 Plus
Dpse\GA18897-PA 1889 GA18897-PA 180..355 28..203 201 31.2 Plus
Dpse\GA27118-PA 629 GA27118-PA 455..605 28..177 195 34.4 Plus
Dpse\GA26616-PC 511 GA26616-PC 80..289 18..246 188 30 Plus
Dpse\GA10197-PA 848 GA10197-PA 17..206 46..234 185 30.5 Plus
Dpse\GA18897-PA 1889 GA18897-PA 25..208 58..242 181 30.1 Plus
Dpse\GA18897-PA 1889 GA18897-PA 156..386 27..255 179 29.5 Plus
Dpse\GA27118-PA 629 GA27118-PA 480..620 30..166 174 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15856-PA 341 GM15856-PA 1..341 1..341 1736 96.5 Plus
Dsec\GM10328-PA 1851 GM10328-PA 112..357 29..270 265 32.5 Plus
Dsec\GM21584-PA 903 GM21584-PA 237..432 28..223 237 29.6 Plus
Dsec\GM21584-PA 903 GM21584-PA 163..406 23..245 231 29.3 Plus
Dsec\GM10328-PA 1851 GM10328-PA 65..307 28..266 228 28.5 Plus
Dsec\GM10328-PA 1851 GM10328-PA 42..254 28..242 224 30.7 Plus
Dsec\GM10328-PA 1851 GM10328-PA 180..352 28..200 222 31.2 Plus
Dsec\GM15368-PA 683 GM15368-PA 156..430 13..244 218 28.7 Plus
Dsec\GM15368-PA 683 GM15368-PA 415..617 20..245 214 28.5 Plus
Dsec\GM25913-PA 898 GM25913-PA 280..581 28..326 212 27.6 Plus
Dsec\GM21584-PA 903 GM21584-PA 99..340 28..265 203 30.3 Plus
Dsec\GM15368-PA 683 GM15368-PA 470..620 28..177 198 35.8 Plus
Dsec\GM10328-PA 1851 GM10328-PA 216..385 18..193 194 31.8 Plus
Dsec\GM10328-PA 1851 GM10328-PA 25..210 58..244 192 29.8 Plus
Dsec\GM25913-PA 898 GM25913-PA 254..444 48..238 184 34 Plus
Dsec\GM21584-PA 903 GM21584-PA 67..299 42..270 182 29.8 Plus
Dsec\GM15368-PA 683 GM15368-PA 495..635 30..166 173 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11618-PA 341 GD11618-PA 1..341 1..341 1748 97.1 Plus
Dsim\GD21289-PA 2647 GD21289-PA 112..357 29..270 265 32.5 Plus
Dsim\GD11090-PA 776 GD11090-PA 62..305 5..223 251 32.8 Plus
Dsim\GD21289-PA 2647 GD21289-PA 65..307 28..266 227 28.5 Plus
Dsim\GD21289-PA 2647 GD21289-PA 42..254 28..242 224 30.7 Plus
Dsim\GD21289-PA 2647 GD21289-PA 180..352 28..200 222 31.2 Plus
Dsim\GD20236-PA 724 GD20236-PA 456..658 20..245 212 28.5 Plus
Dsim\GD20236-PA 724 GD20236-PA 209..471 28..244 211 28.8 Plus
Dsim\GD11090-PA 776 GD11090-PA 45..279 28..245 204 30.4 Plus
Dsim\GD20236-PA 724 GD20236-PA 511..661 28..177 196 35.8 Plus
Dsim\GD21289-PA 2647 GD21289-PA 216..385 18..193 194 31.8 Plus
Dsim\GD20236-PA 724 GD20236-PA 388..632 23..243 192 26.3 Plus
Dsim\GD21289-PA 2647 GD21289-PA 25..210 58..244 191 29.8 Plus
Dsim\GD24888-PA 1125 GD24888-PA 104..361 27..275 181 30.1 Plus
Dsim\GD11090-PA 776 GD11090-PA 13..181 42..210 178 30.8 Plus
Dsim\GD20236-PA 724 GD20236-PA 536..676 30..166 172 35.5 Plus
Dsim\GD20236-PA 724 GD20236-PA 198..358 65..223 162 30.4 Plus
Dsim\GD24888-PA 1125 GD24888-PA 174..404 27..254 160 29.7 Plus
Dsim\GD24888-PA 1125 GD24888-PA 57..275 28..242 160 32 Plus
Dsim\GD24888-PA 1125 GD24888-PA 7..194 73..256 157 29.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21310-PA 337 GJ21310-PA 1..337 1..341 1166 67 Plus
Dvir\GJ21726-PA 861 GJ21726-PA 110..333 23..223 247 31.2 Plus
Dvir\GJ21726-PA 861 GJ21726-PA 184..380 28..224 241 29.9 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 126..400 13..244 212 28 Plus
Dvir\GJ21726-PA 861 GJ21726-PA 46..258 28..242 210 31.6 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 103..354 18..246 208 31.9 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 385..587 20..245 200 27.2 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 440..590 28..177 192 34.4 Plus
Dvir\GJ21606-PA 237 GJ21606-PA 37..222 28..206 183 32.3 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 137..382 4..250 182 28.5 Plus
Dvir\GJ22826-PA 614 GJ22826-PA 465..605 30..166 173 35.5 Plus
Dvir\GJ21726-PA 861 GJ21726-PA 43..207 71..234 169 31.5 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 548..735 22..207 157 28.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10741-PA 345 GK10741-PA 1..345 1..341 1261 69.6 Plus
Dwil\GK13318-PA 1874 GK13318-PA 112..357 29..270 266 32.5 Plus
Dwil\GK21518-PA 831 GK21518-PA 183..379 28..224 245 30.5 Plus
Dwil\GK21518-PA 831 GK21518-PA 94..352 10..245 243 29.5 Plus
Dwil\GK13318-PA 1874 GK13318-PA 65..307 28..266 227 28.5 Plus
Dwil\GK13318-PA 1874 GK13318-PA 42..254 28..242 226 30.7 Plus
Dwil\GK13318-PA 1874 GK13318-PA 180..352 28..200 216 30.6 Plus
Dwil\GK11454-PA 641 GK11454-PA 153..427 13..244 211 28 Plus
Dwil\GK21518-PA 831 GK21518-PA 45..257 28..242 206 30.7 Plus
Dwil\GK11454-PA 641 GK11454-PA 467..617 28..177 203 35.8 Plus
Dwil\GK19942-PA 1261 GK19942-PA 104..361 27..275 202 31.8 Plus
Dwil\GK11454-PA 641 GK11454-PA 412..614 20..245 196 27.2 Plus
Dwil\GK13318-PA 1874 GK13318-PA 216..385 18..193 193 31.8 Plus
Dwil\GK13318-PA 1874 GK13318-PA 25..210 58..244 192 29.8 Plus
Dwil\GK21518-PA 831 GK21518-PA 22..213 28..244 183 28.1 Plus
Dwil\GK11454-PA 641 GK11454-PA 492..632 30..166 176 35.5 Plus
Dwil\GK19942-PA 1261 GK19942-PA 174..447 27..307 173 27.3 Plus
Dwil\GK19942-PA 1261 GK19942-PA 57..275 28..242 170 32.4 Plus
Dwil\GK19942-PA 1261 GK19942-PA 7..194 73..256 164 31.1 Plus
Dwil\GK19942-PA 1261 GK19942-PA 12..202 53..240 153 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12214-PA 341 GE12214-PA 1..341 1..341 1699 94.4 Plus
Dyak\GE23676-PA 1857 GE23676-PA 112..323 29..242 238 34.1 Plus
Dyak\GE13624-PA 849 GE13624-PA 109..352 23..245 236 29.7 Plus
Dyak\GE13624-PA 849 GE13624-PA 183..379 28..224 231 28.9 Plus
Dyak\GE24170-PA 645 GE24170-PA 157..431 13..244 216 28.7 Plus
Dyak\GE24170-PA 645 GE24170-PA 416..618 20..245 212 28.5 Plus
Dyak\GE23676-PA 1857 GE23676-PA 65..277 28..242 211 29.3 Plus
Dyak\GE23676-PA 1857 GE23676-PA 48..254 34..242 211 30.6 Plus
Dyak\GE13624-PA 849 GE13624-PA 45..286 28..265 209 30.7 Plus
Dyak\GE23676-PA 1857 GE23676-PA 180..355 28..203 201 31.2 Plus
Dyak\GE24422-PA 928 GE24422-PA 311..612 28..326 198 27.2 Plus
Dyak\GE24170-PA 645 GE24170-PA 471..621 28..177 197 35.8 Plus
Dyak\GE13624-PA 849 GE13624-PA 13..245 42..270 190 30.6 Plus
Dyak\GE23676-PA 1857 GE23676-PA 25..208 58..242 182 30.1 Plus
Dyak\GE24170-PA 645 GE24170-PA 496..636 30..166 173 35.5 Plus
Dyak\GE23676-PA 1857 GE23676-PA 226..384 28..192 172 32.7 Plus
Dyak\GE24422-PA 928 GE24422-PA 285..475 48..238 172 33.5 Plus