Clone GH17932 Report

Search the DGRC for GH17932

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:179
Well:32
Vector:pOT2
Associated Gene/TranscriptCG3663-RA
Protein status:GH17932.pep: gold
Preliminary Size:940
Sequenced Size:782

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3663 2001-01-01 Release 2 assignment
CG3663 2001-10-10 Blastp of sequenced clone
CG3663 2003-01-01 Sim4 clustering to Release 3
CG3663 2008-04-29 Release 5.5 accounting
CG3663 2008-08-15 Release 5.9 accounting
CG3663 2008-12-18 5.12 accounting

Clone Sequence Records

GH17932.complete Sequence

782 bp (782 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060731

> GH17932.complete
ATTTGCAGTTTATTTAACAAGTGAACATTGCGTATTTTCTAAGCCGAATC
TAGTAAATAGTGTGAAACAAAATGGCCCTGCGACGCTGTCACTTGAACCC
GAAGAAAACGCTTTTCCTGTTGTGCGACATTCAAGAAAAGTTCCGACCGG
CCATGCCGCTCTTTGATAACATGATCAAAAACGTCGACAAACTAACTCGG
GCGGGAAAGGCTTTAGATGTTCCTCTGATTGTAACCGAACACTATCCGGA
AAAACTAGGAAAAACAGTGGCCCAACTGGATGTAAGCCATGCGAAGCTGG
TCTCCGGTAAAACCCTTTTCAGCATGTTTACTCCCGAAGTCAAGGCTGTG
ATCAAGGATATCTTCAATGACAAGCCAGAGGATGTCGTGCTATATGGCCT
CGAGTCCCACATTTGCGTGGAGCAGACCGCCATCGATCTCCTCGAGCAAA
ACATCAACGTATACATAGTGGCGGACTGCTGCTCCTCCAGGCTGAACCAG
GATCGAGATCTAGCCCTGGATCGCCTGCGTCAAGCGGGCTGTGTGATCAC
CACTAGTGAGAGCGTTATCTTCGACTTGGTTCGAGATAAGAACAACCCCA
AGTTCGATGTGGTCCGGAAATTGGTGAACCAGCCGTCGGTGGATATGGAA
CTCACGCGCAACGGGAGCGGAGTGCCAGCGGGCAGTGCCAAGCTGTGAGA
TAGCCCCTCCTGTCTAAATATCTGTTTGTTATAAAGCCAATTGCATTTAT
AAAACCATCAAAAAAAAAAAAAAAAAAAAAAA

GH17932.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG3663-RA 1056 CG3663-RA 36..795 1..760 3800 100 Plus
CG3663.a 749 CG3663.a 4..407 1..404 2020 100 Plus
CG3663.a 749 CG3663.a 406..742 424..760 1685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20547945..20548301 403..759 1785 100 Plus
chr2R 21145070 chr2R 20547680..20547889 195..404 1050 100 Plus
chr2R 21145070 chr2R 20547416..20547609 1..194 970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:57:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24662053..24662410 403..760 1790 100 Plus
2R 25286936 2R 24661788..24661997 195..404 1050 100 Plus
2R 25286936 2R 24661524..24661717 1..194 970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24663252..24663609 403..760 1790 100 Plus
2R 25260384 2R 24662987..24663196 195..404 1050 100 Plus
2R 25260384 2R 24662723..24662916 1..194 970 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:21:58 has no hits.

GH17932.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:23:01 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20547416..20547609 1..194 100 -> Plus
chr2R 20547680..20547889 195..404 100 -> Plus
chr2R 20547947..20548301 405..759 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:47:25 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..627 72..698 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:46 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..627 72..698 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:25:49 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..627 72..698 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:55 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..627 72..698 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:49 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..627 72..698 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:36:38 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..759 1..759 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:46 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..759 1..759 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:25:49 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 22..780 1..759 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:55 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 1..759 1..759 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:49 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
CG3663-RA 22..780 1..759 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:01 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24661524..24661717 1..194 100 -> Plus
2R 24661788..24661997 195..404 100 -> Plus
2R 24662055..24662409 405..759 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:01 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24661524..24661717 1..194 100 -> Plus
2R 24661788..24661997 195..404 100 -> Plus
2R 24662055..24662409 405..759 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:01 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24661524..24661717 1..194 100 -> Plus
2R 24661788..24661997 195..404 100 -> Plus
2R 24662055..24662409 405..759 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:25:49 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20549311..20549520 195..404 100 -> Plus
arm_2R 20549047..20549240 1..194 100 -> Plus
arm_2R 20549578..20549932 405..759 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:21:13 Download gff for GH17932.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24663005..24663214 195..404 100 -> Plus
2R 24663272..24663626 405..759 100   Plus
2R 24662741..24662934 1..194 100 -> Plus

GH17932.hyp Sequence

Translation from 71 to 697

> GH17932.hyp
MALRRCHLNPKKTLFLLCDIQEKFRPAMPLFDNMIKNVDKLTRAGKALDV
PLIVTEHYPEKLGKTVAQLDVSHAKLVSGKTLFSMFTPEVKAVIKDIFND
KPEDVVLYGLESHICVEQTAIDLLEQNINVYIVADCCSSRLNQDRDLALD
RLRQAGCVITTSESVIFDLVRDKNNPKFDVVRKLVNQPSVDMELTRNGSG
VPAGSAKL*

GH17932.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG3663-PA 208 CG3663-PA 1..208 1..208 1065 100 Plus
CG11333-PA 204 CG11333-PA 12..200 8..196 583 58.7 Plus

GH17932.pep Sequence

Translation from 71 to 697

> GH17932.pep
MALRRCHLNPKKTLFLLCDIQEKFRPAMPLFDNMIKNVDKLTRAGKALDV
PLIVTEHYPEKLGKTVAQLDVSHAKLVSGKTLFSMFTPEVKAVIKDIFND
KPEDVVLYGLESHICVEQTAIDLLEQNINVYIVADCCSSRLNQDRDLALD
RLRQAGCVITTSESVIFDLVRDKNNPKFDVVRKLVNQPSVDMELTRNGSG
VPAGSAKL*

GH17932.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12999-PA 208 GF12999-PA 1..208 1..208 1006 90.9 Plus
Dana\GF17786-PA 205 GF17786-PA 9..203 8..202 624 60.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22997-PA 208 GG22997-PA 1..208 1..208 1047 94.2 Plus
Dere\GG11809-PA 204 GG11809-PA 11..200 7..196 599 58.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20327-PA 201 GH20327-PA 1..197 1..197 905 84.8 Plus
Dgri\GH19318-PA 183 GH19318-PA 1..173 16..194 540 56.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG3663-PA 208 CG3663-PA 1..208 1..208 1065 100 Plus
CG11333-PA 204 CG11333-PA 12..200 8..196 583 58.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19998-PA 201 GI19998-PA 1..197 1..197 900 84.3 Plus
Dmoj\GI22207-PA 209 GI22207-PA 12..206 8..207 612 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11107-PA 187 GL11107-PA 1..187 1..208 842 79.3 Plus
Dper\GL27251-PA 207 GL27251-PA 11..200 7..196 579 56.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17597-PA 208 GA17597-PA 1..208 1..208 998 90.4 Plus
Dpse\GA10927-PA 207 GA10927-PA 11..200 7..196 578 56.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11891-PA 208 GM11891-PA 1..208 1..208 1079 98.1 Plus
Dsec\GM12943-PA 204 GM12943-PA 8..200 2..196 594 57.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11889-PA 333 GD11889-PA 1..180 1..180 952 100 Plus
Dsim\GD21579-PA 204 GD21579-PA 11..200 7..196 600 58.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21248-PA 201 GJ21248-PA 1..199 1..199 935 87.4 Plus
Dvir\GJ24328-PA 209 GJ24328-PA 12..200 8..196 596 57.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21424-PA 205 GK21424-PA 1..202 1..201 943 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14434-PA 208 GE14434-PA 1..208 1..208 1055 95.2 Plus
Dyak\GE10943-PA 204 GE10943-PA 11..200 7..196 605 58.9 Plus