Clone GH17960 Report

Search the DGRC for GH17960

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:179
Well:60
Vector:pOT2
Associated Gene/TranscriptGstZ2-RA
Protein status:GH17960.pep: gold
Preliminary Size:1178
Sequenced Size:1057

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9363 2001-01-01 Release 2 assignment
CG9363 2003-01-01 Sim4 clustering to Release 3
CG9363 2003-01-15 Blastp of sequenced clone
CG9363 2008-04-29 Release 5.5 accounting
CG9363 2008-08-15 Release 5.9 accounting
CG9363 2008-12-18 5.12 accounting

Clone Sequence Records

GH17960.complete Sequence

1057 bp (1057 high quality bases) assembled on 2003-01-15

GenBank Submission: AY060732

> GH17960.complete
AAAATGTCTACTAATCTCTGTCCCAATGCTTCCTCCTCCGACATACAGCC
AATACTCTACTCGTATTGGCGCAGCTCGTGCTCCTGGCGCGTGCGCATTG
CGATGAACCTGAAGGAGATACCCTACGACATCAAGCCGATCAGCCTGATC
AAATCCGGTGGCGAGCAGCACTGCAATGAGTACCGCGAGGTGAATCCAAT
GGAGCAGGTGCCCGCCCTACAGATTGATGGACACACCCTCATCGAATCGG
TAGCCATAATGCACTACCTGGAGGAAACACGTCCCCAGCGACCACTCCTG
CCACAGGACGTCCACAAGCGGGCCAAGGTGCGCGAAATAGTCGAGATCAT
TTGCTCTGGCATCCAGCCCCTGCAGAACCTCATCGTGCTCATCCATGTGG
GCGAGGAGAAGAAGAAGGAGTGGGCCCAGCACTGGATTACACGAGGCTTC
CGGGCGGTTGAGAAGGCGCTGTCCACTTCGGCCGGCAAATATTGCGTGGG
CGATGAGATCTCCATGGCGGACTGCTGCCTCGTACCTCAGGTGTTCAATG
CCCGAAGATTCCACGTCGACTTGCGACCGTATCCCATAATTCTGCGCATC
GATCGCGAACTGGAGAGCAATCCGGCATTCCGGGCGGCCCATCCCTCCAA
TCAACCGGACTGTCCGCCGGAGCTGCCCAACAAATAGAATTTTCCGACCC
CAACTGCAAAGCGCCGTAAGACGAAAAAGTGAATTGCAGTTCGTAAACCA
GGCACAAGACAAACTAAGAACTTAAATCTGATCGGTGGGCACGTGGATGG
CGATGGCGATGGAGAATGGATTGGATAGGATGGCAAAGCTGGCGAGGATT
CCATTAAGCAGAAACAGTCGGATGTGATTTAAGAAATTGCTAACAGCATT
TAAATATGCATAAATGCATAAAAATACTATCGATAACATAACGAAATTCC
TCACACGAAATTCAAACGCAAACGCAAACGCAAAATTCTCAGAAAACGGA
ACAAAAAATCGTATAATAAATTCTTCAAATTCCCTTAAAAAAAAAAAAAA
AAAAAAA

GH17960.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG9363.b 1906 CG9363.b 28..1064 1..1037 5185 100 Plus
CG9363-RA 1241 CG9363-RA 38..1074 1..1037 5185 100 Plus
CG9363-RB 1620 CG9363-RB 463..1453 47..1037 4955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5283492..5283972 1036..556 2405 100 Minus
chr3R 27901430 chr3R 5284048..5284379 557..226 1660 100 Minus
chr3R 27901430 chr3R 5284440..5284665 226..1 1130 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:57:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9457646..9458127 1037..556 2410 100 Minus
3R 32079331 3R 9458203..9458534 557..226 1660 100 Minus
3R 32079331 3R 9458595..9458820 226..1 1130 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9198477..9198958 1037..556 2410 100 Minus
3R 31820162 3R 9199034..9199365 557..226 1660 100 Minus
3R 31820162 3R 9199426..9199651 226..1 1130 100 Minus
3R 31820162 3R 9196617..9196748 552..421 165 75 Minus
Blast to na_te.dros performed on 2019-03-16 01:12:14 has no hits.

GH17960.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:13:11 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5283492..5283970 558..1036 100 <- Minus
chr3R 5284048..5284378 227..557 100 <- Minus
chr3R 5284440..5284665 1..226 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:47:28 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RA 1..684 4..687 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:38 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RA 1..684 4..687 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:32 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RA 1..684 4..687 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:32 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RA 1..684 4..687 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:26:39 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RA 1..684 4..687 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:28 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RA 24..1059 1..1036 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:38 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RA 24..1059 1..1036 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:32 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RA 27..1062 1..1036 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:32 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
CG9363-RA 24..1059 1..1036 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:26:39 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
GstZ2-RA 27..1062 1..1036 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:11 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9457647..9458125 558..1036 100 <- Minus
3R 9458203..9458533 227..557 100 <- Minus
3R 9458595..9458820 1..226 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:11 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9457647..9458125 558..1036 100 <- Minus
3R 9458203..9458533 227..557 100 <- Minus
3R 9458595..9458820 1..226 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:11 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9457647..9458125 558..1036 100 <- Minus
3R 9458203..9458533 227..557 100 <- Minus
3R 9458595..9458820 1..226 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:32 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5284317..5284542 1..226 100   Minus
arm_3R 5283369..5283847 558..1036 100 <- Minus
arm_3R 5283925..5284255 227..557 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:49 Download gff for GH17960.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9198478..9198956 558..1036 100 <- Minus
3R 9199034..9199364 227..557 100 <- Minus
3R 9199426..9199651 1..226 100   Minus

GH17960.hyp Sequence

Translation from 0 to 686

> GH17960.hyp
KMSTNLCPNASSSDIQPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLI
KSGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETRPQRPLL
PQDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGF
RAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRI
DRELESNPAFRAAHPSNQPDCPPELPNK*

GH17960.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
GstZ2-PA 227 CG9363-PA 1..227 2..228 1214 100 Plus
GstZ2-PB 220 CG9363-PB 4..220 12..228 1139 98.2 Plus
GstZ2-PC 215 CG9363-PC 4..215 17..228 1137 100 Plus
GstZ1-PA 246 CG9362-PA 33..246 16..228 790 66.8 Plus
gfzf-PD 234 CG33546-PD 3..181 19..197 147 25.5 Plus

GH17960.pep Sequence

Translation from 3 to 686

> GH17960.pep
MSTNLCPNASSSDIQPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIK
SGGEQHCNEYREVNPMEQVPALQIDGHTLIESVAIMHYLEETRPQRPLLP
QDVHKRAKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFR
AVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRID
RELESNPAFRAAHPSNQPDCPPELPNK*

GH17960.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17762-PA 220 GF17762-PA 4..220 11..227 1136 98.2 Plus
Dana\GF17763-PA 250 GF17763-PA 23..249 2..227 719 58.6 Plus
Dana\GF12161-PA 223 GF12161-PA 7..200 17..210 149 27.9 Plus
Dana\GF12160-PA 223 GF12160-PA 7..206 17..216 147 28 Plus
Dana\GF17320-PA 1018 GF17320-PA 782..970 14..198 147 24.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17371-PA 220 GG17371-PA 4..220 11..227 1136 98.2 Plus
Dere\GG17372-PA 246 GG17372-PA 25..246 7..227 776 63.5 Plus
Dere\GG10036-PA 1042 GG10036-PA 814..994 18..198 165 26.3 Plus
Dere\GG21881-PA 223 GG21881-PA 2..180 10..192 151 30.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19138-PA 220 GH19138-PA 4..220 11..227 1134 97.7 Plus
Dgri\GH19140-PA 247 GH19140-PA 23..242 10..227 760 63.2 Plus
Dgri\GH19139-PA 218 GH19139-PA 13..214 10..219 731 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
GstZ2-PA 227 CG9363-PA 1..227 1..227 1214 100 Plus
GstZ2-PB 220 CG9363-PB 4..220 11..227 1139 98.2 Plus
GstZ2-PC 215 CG9363-PC 4..215 16..227 1137 100 Plus
GstZ1-PA 246 CG9362-PA 33..246 15..227 790 66.8 Plus
gfzf-PD 234 CG33546-PD 3..181 18..196 147 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23596-PA 220 GI23596-PA 4..220 11..227 1134 97.7 Plus
Dmoj\GI23597-PA 246 GI23597-PA 31..246 13..227 793 68.7 Plus
Dmoj\GI20133-PA 225 GI20133-PA 8..205 15..211 141 24.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13668-PA 240 GL13668-PA 4..240 11..227 1107 89.9 Plus
Dper\GL13669-PA 256 GL13669-PA 43..256 15..227 801 67.9 Plus
Dper\GL12196-PA 1039 GL12196-PA 810..989 18..196 149 25.9 Plus
Dper\GL15503-PA 241 GL15503-PA 35..197 29..186 145 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21732-PA 220 GA21732-PA 4..220 11..227 1136 98.2 Plus
Dpse\GA21731-PA 231 GA21731-PA 18..231 15..227 799 67.3 Plus
Dpse\GA26222-PB 232 GA26222-PB 3..182 18..196 156 25.9 Plus
Dpse\GA26222-PA 1039 GA26222-PA 810..989 18..196 151 25.9 Plus
Dpse\GA23844-PA 241 GA23844-PA 35..197 29..186 143 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26256-PA 220 GM26256-PA 4..220 11..227 1136 98.2 Plus
Dsec\GM26257-PA 246 GM26257-PA 33..246 15..227 790 66.8 Plus
Dsec\GM10504-PA 265 GM10504-PA 35..213 18..196 169 27.1 Plus
Dsec\GM21880-PA 222 GM21880-PA 18..202 30..213 143 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:45:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20795-PA 220 GD20795-PA 4..220 11..227 1136 98.2 Plus
Dsim\GD20796-PA 246 GD20796-PA 33..246 15..227 800 67.8 Plus
Dsim\GD19500-PA 1038 GD19500-PA 808..986 18..196 168 27.2 Plus
Dsim\GD11374-PA 222 GD11374-PA 18..202 30..213 147 26.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23570-PA 220 GJ23570-PA 4..220 11..227 1134 97.7 Plus
Dvir\GJ23571-PA 162 GJ23571-PA 1..162 66..227 672 75.3 Plus
Dvir\GJ19903-PA 228 GJ19903-PA 2..205 8..210 152 23.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12126-PA 220 GK12126-PA 4..220 11..227 1136 98.2 Plus
Dwil\GK12127-PA 246 GK12127-PA 12..243 1..223 722 57.3 Plus
Dwil\GK12738-PA 1061 GK12738-PA 832..1012 18..198 162 25.3 Plus
Dwil\GK23004-PA 226 GK23004-PA 4..201 15..210 147 23.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24775-PA 220 GE24775-PA 4..220 11..227 1136 98.2 Plus
Dyak\GE24777-PA 246 GE24777-PA 25..246 7..227 790 64.4 Plus
Dyak\GE25813-PA 1042 GE25813-PA 814..992 18..196 165 27.2 Plus
Dyak\GE11962-PA 222 GE11962-PA 18..205 30..216 148 27.7 Plus