BDGP Sequence Production Resources |
Search the DGRC for GH18251
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 182 |
Well: | 51 |
Vector: | pOT2 |
Associated Gene/Transcript | CG6762-RA |
Protein status: | GH18251.pep: gold |
Sequenced Size: | 767 |
Gene | Date | Evidence |
---|---|---|
CG6762 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6762 | 2008-04-29 | Release 5.5 accounting |
CG6762 | 2008-08-15 | Release 5.9 accounting |
CG6762 | 2008-12-18 | 5.12 accounting |
767 bp (767 high quality bases) assembled on 2005-06-20
GenBank Submission: BT023718
> GH18251.complete CAAAACAACATATAGCGGTAAACGAACCCACACATGAGCAGCAAACAAGT TTCAACGCCGTGCGGTGTCAAAAATCGTGCAATTGTCCGCCATGGAGTTC ATTAGCCATTTCTTGCGAGCGACGAGCAGACGCACCGCCGCATTGGGTCC AATCCTGCAAAGAAATCGTAGCGAAATCATCCAAAAACAATCTTTGACCA ATCGACAGGCATTCCGCAGATACAGATCCAGCTGCAGCACCATGGACACC ACCGTTCACTCCGCCGGCATCGATGAGACCCACCTGGTGCCCATGAGCGT CATCCAGCGACCCATTCCCTCCGTCCTGGACGAGCAGAAGGTGCAATCCC TGATGGAAACCATTAAGAACGAAACCAGCGAAGATGAGGTGCCCCCCATC GACCTGCTGTGGATCTCGGGCAGCGAGGGAGGCGACTACTACTTCAGCTT CGGCGGATGCCACCGGTTCGAGGCGTACAAGCGGCTACAGCGGCCGACGA TCAAGGCGAAGCTGGTGAAGTCCACACTGGGCGATCTGTATCACTACATG GGCTCCAGCGCGCCCAAGTACCTGGCCTGATCTTTGTCGCTGATCATTTG TTGTTGTTGTGCATTTGTTTTTGATAAGAATGTCGTGATCGCTGGATAAA GTTCGAAATTCACGGACATAGCAATAAGAAAAGCTTTATTCTTTGTTTTC GTAAATTTCTTTTGTTTTTTTTAATAAAGTTTTTTATTTGGCAATCGTTA AAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6762.d | 861 | CG6762.d | 113..861 | 1..749 | 3745 | 100 | Plus |
CG6762-RA | 976 | CG6762-RA | 243..976 | 1..734 | 3670 | 100 | Plus |
CG6762.b | 972 | CG6762.b | 432..972 | 209..749 | 2705 | 100 | Plus |
CG6762.b | 972 | CG6762.b | 243..431 | 1..189 | 945 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 17747396..17747779 | 366..749 | 1905 | 99.7 | Plus |
chrX | 22417052 | chrX | 17746516..17746704 | 1..189 | 945 | 100 | Plus |
chrX | 22417052 | chrX | 17746819..17746996 | 190..367 | 890 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy9 | 5349 | gypsy9 GYPSY9 5349bp | 444..588 | 727..591 | 110 | 57.9 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 17746516..17746704 | 1..189 | 100 | -> | Plus |
chrX | 17746819..17746996 | 190..367 | 100 | -> | Plus |
chrX | 17747398..17747779 | 368..749 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..489 | 92..580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..489 | 92..580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..489 | 92..580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..489 | 92..580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..489 | 92..580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..580 | 1..580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..749 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 59..807 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 1..580 | 1..580 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6762-RA | 59..807 | 1..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17857170..17857358 | 1..189 | 100 | -> | Plus |
X | 17857473..17857650 | 190..367 | 100 | -> | Plus |
X | 17858052..17858433 | 368..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17857170..17857358 | 1..189 | 100 | -> | Plus |
X | 17857473..17857650 | 190..367 | 100 | -> | Plus |
X | 17858052..17858433 | 368..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17857170..17857358 | 1..189 | 100 | -> | Plus |
X | 17857473..17857650 | 190..367 | 100 | -> | Plus |
X | 17858052..17858433 | 368..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 17751203..17751391 | 1..189 | 100 | -> | Plus |
arm_X | 17751506..17751683 | 190..367 | 100 | -> | Plus |
arm_X | 17752085..17752466 | 368..749 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 17866150..17866531 | 368..749 | 100 | Plus | |
X | 17865268..17865456 | 1..189 | 100 | -> | Plus |
X | 17865571..17865748 | 190..367 | 100 | -> | Plus |
Translation from 91 to 579
> GH18251.hyp MEFISHFLRATSRRTAALGPILQRNRSEIIQKQSLTNRQAFRRYRSSCST MDTTVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEV PPIDLLWISGSEGGDYYFSFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLY HYMGSSAPKYLA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6762-PA | 162 | CG6762-PA | 1..162 | 1..162 | 835 | 100 | Plus |
CG6762-PD | 152 | CG6762-PD | 1..152 | 1..162 | 765 | 93.8 | Plus |
CG6762-PC | 112 | CG6762-PC | 1..112 | 51..162 | 587 | 100 | Plus |
CG6762-PB | 112 | CG6762-PB | 1..112 | 51..162 | 587 | 100 | Plus |
Translation from 91 to 579
> GH18251.pep MEFISHFLRATSRRTAALGPILQRNRSEIIQKQSLTNRQAFRRYRSSCST MDTTVHSAGIDETHLVPMSVIQRPIPSVLDEQKVQSLMETIKNETSEDEV PPIDLLWISGSEGGDYYFSFGGCHRFEAYKRLQRPTIKAKLVKSTLGDLY HYMGSSAPKYLA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21110-PA | 112 | GF21110-PA | 1..112 | 51..162 | 541 | 88.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19136-PA | 162 | GG19136-PA | 1..162 | 1..162 | 823 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12141-PA | 112 | GH12141-PA | 1..112 | 51..162 | 512 | 83 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6762-PA | 162 | CG6762-PA | 1..162 | 1..162 | 835 | 100 | Plus |
CG6762-PD | 152 | CG6762-PD | 1..152 | 1..162 | 765 | 93.8 | Plus |
CG6762-PC | 112 | CG6762-PC | 1..112 | 51..162 | 587 | 100 | Plus |
CG6762-PB | 112 | CG6762-PB | 1..112 | 51..162 | 587 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16197-PA | 115 | GI16197-PA | 2..115 | 49..162 | 506 | 78.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14755-PA | 150 | GL14755-PA | 1..150 | 1..162 | 574 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19844-PA | 150 | GA19844-PA | 1..150 | 1..162 | 584 | 69.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22861-PA | 162 | GM22861-PA | 1..162 | 1..162 | 853 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17370-PA | 162 | GD17370-PA | 1..162 | 1..162 | 848 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15889-PA | 115 | GJ15889-PA | 2..115 | 49..162 | 520 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25764-PA | 111 | GK25764-PA | 1..110 | 51..161 | 490 | 82 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17693-PA | 163 | GE17693-PA | 1..163 | 1..162 | 759 | 92.7 | Plus |