BDGP Sequence Production Resources |
Search the DGRC for GH18280
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 182 |
Well: | 80 |
Vector: | pOT2 |
Associated Gene/Transcript | PGRP-LA-RD |
Protein status: | GH18280.pep: gold |
Preliminary Size: | 1423 |
Sequenced Size: | 1305 |
Gene | Date | Evidence |
---|---|---|
CG4384 | 2001-01-01 | Release 2 assignment |
CG18614 | 2001-01-01 | Release 2 assignment |
CG32042 | 2001-09-19 | Blastp of sequenced clone |
CG32042 | 2003-01-01 | Sim4 clustering to Release 3 |
PGRP-LA | 2008-04-29 | Release 5.5 accounting |
PGRP-LA | 2008-08-15 | Release 5.9 accounting |
PGRP-LA | 2008-12-18 | 5.12 accounting |
1305 bp (1305 high quality bases) assembled on 2001-09-19
GenBank Submission: AY060314
> GH18280.complete ACTGGCGCGCCAGCTACGTACTCCGGAAAGAGTCACGGATTTTCTGAGAT TTGATCATCTGAGATCGTCATATTCAAGCAACCCTTTTTAAAACATAAAC AAGCAATCCAAAACGAATCGGCAATGTTCGAGGAAAACAATAGCCCCACA ACCGATAATTCGCTGTGGACACTTCAGGGTCGTCAAAGAGCGAGTCCCGC CCAAAGGTTGCACAATCTCACGTCCGCCGGCTCATCGACCTCATCCTCCG GCCTTCCGTTACCGCAGAATATCTTCACAAATCCAGCTATCCAGCCGTCC AGCGTTATAAATCTCAACCACTCCACCGACGTGGTAATCGGTCCCATGAC CCAATACCAGGGACCGGTATCCATATACTATATGGATTATATGGAGGCAC ACGCCATGCAAACGGCTGCAGGAATCAACAGCAACAATGCCAATGGTAAT GGCAACGCCAATCGAAGTCGTGATAAGTCGCCATCTAGGCGGGTCACTCG GAACACCATCCTGCTGATCACGCTGATCCTGTTGGTCCTGGCCACCGGAT TGATTGTGCTCTACGTGGAACTCAATCGACCCAAGCCCGAGTTGCCCAGT AATAAAGCCATCTATTTTGGCAACAACTACGACCACCAAACGTGAAACGG CCATCTCGTCGTCGACAGAGAGCAGTGGGGAGCGTCGAAGAACTCTCATG GTCTGACCATTCCCCTGAAGCGACCCATTCCCTACGTCCTAATCACCCAC ATTGGAGTGCAGTCTCTGCCCTGCGATAACATCTACAAGTGCTCCATCAA GATGCGCACCATTCAGGATTCAGCCATTGCTGAGAAGGGTCTGCCGGATA TCCAATCCAATTTTTATGTTTCGGAGGAGGGTAACATCTACGTTGGCCGC GGCTGGGACTGGGCCAACACGTATGCGAACCAGACATTGGCCATTACCTT TATGGGCGACTATGGCCGGTTTAAGCCCGGTCCCAAACAGCTGGAAGGTG TCCAATTTCTGCTGGCCCATGCAGTGGCCAATCGAAATATTGATGTGGAC TACAAACTAGTGGCGCAAAATCAGACTAAGGTGACCAGAAGCCCGGGTGC ATATGTGTATCAAGAAATCCGGAACTGGCCGCATTTCTACGGCTGCGGAA TGGACGAAGCACCGGCCTGCGGCATCGAATTGGGCATGAAAACGGAATCG TGGGACGCCAAGCAATAGCTACAGACTTTTCTACCACCTAAGTGTAACCA AGCACAAACTGTATTTTAATACATATACTAAGGCGAAAAAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
PGRP-LA.b | 1655 | PGRP-LA.b | 2..1288 | 1..1287 | 6435 | 100 | Plus |
PGRP-LA-RD | 1358 | PGRP-LA-RD | 2..1288 | 1..1287 | 6435 | 100 | Plus |
PGRP-LA-RE | 1850 | PGRP-LA-RE | 660..1303 | 644..1287 | 3220 | 100 | Plus |
PGRP-LA-RE | 1850 | PGRP-LA-RE | 5..647 | 1..643 | 3215 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 9326553..9326873 | 102..422 | 1500 | 97.8 | Plus |
chr3L | 24539361 | chr3L | 9328935..9329160 | 644..869 | 1130 | 100 | Plus |
chr3L | 24539361 | chr3L | 9328647..9328871 | 420..644 | 1095 | 99.1 | Plus |
chr3L | 24539361 | chr3L | 9329391..9329597 | 868..1074 | 1005 | 99 | Plus |
chr3L | 24539361 | chr3L | 9329659..9329871 | 1072..1285 | 1005 | 99.1 | Plus |
chr3L | 24539361 | chr3L | 9326278..9326380 | 1..103 | 515 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 9334608..9334928 | 102..422 | 1605 | 100 | Plus |
3L | 28110227 | 3L | 9336998..9337223 | 644..869 | 1130 | 100 | Plus |
3L | 28110227 | 3L | 9336710..9336934 | 420..644 | 1125 | 100 | Plus |
3L | 28110227 | 3L | 9337723..9337938 | 1072..1287 | 1080 | 100 | Plus |
3L | 28110227 | 3L | 9337454..9337660 | 868..1074 | 1035 | 100 | Plus |
3L | 28110227 | 3L | 9334333..9334435 | 1..103 | 515 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 9327708..9328028 | 102..422 | 1605 | 100 | Plus |
3L | 28103327 | 3L | 9330098..9330323 | 644..869 | 1130 | 100 | Plus |
3L | 28103327 | 3L | 9329810..9330034 | 420..644 | 1125 | 100 | Plus |
3L | 28103327 | 3L | 9330823..9331038 | 1072..1287 | 1080 | 100 | Plus |
3L | 28103327 | 3L | 9330554..9330760 | 868..1074 | 1035 | 100 | Plus |
3L | 28103327 | 3L | 9327433..9327535 | 1..103 | 515 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
412 | 7567 | 412 412 7567bp | 3118..3179 | 387..445 | 112 | 71 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 9326555..9326872 | 104..421 | 97 | -> | Plus |
chr3L | 9328649..9328870 | 422..643 | 99 | -> | Plus |
chr3L | 9326278..9326380 | 1..103 | 100 | -> | Plus |
chr3L | 9328935..9329158 | 644..867 | 100 | -> | Plus |
chr3L | 9329391..9329597 | 868..1074 | 99 | -> | Plus |
chr3L | 9329662..9329871 | 1075..1285 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RF | 89..900 | 419..1218 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RF | 89..900 | 419..1218 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RE | 1..1107 | 124..1218 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RF | 89..900 | 419..1218 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RE | 1..1107 | 124..1218 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RD | 2..1286 | 1..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RD | 2..1286 | 1..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RD | 2..1286 | 1..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RD | 2..1286 | 1..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
PGRP-LA-RD | 2..1286 | 1..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9337454..9337660 | 868..1074 | 100 | -> | Plus |
3L | 9334333..9334435 | 1..103 | 100 | -> | Plus |
3L | 9334610..9334927 | 104..421 | 100 | -> | Plus |
3L | 9336712..9336933 | 422..643 | 100 | -> | Plus |
3L | 9336998..9337221 | 644..867 | 100 | -> | Plus |
3L | 9337726..9337936 | 1075..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9337454..9337660 | 868..1074 | 100 | -> | Plus |
3L | 9334333..9334435 | 1..103 | 100 | -> | Plus |
3L | 9334610..9334927 | 104..421 | 100 | -> | Plus |
3L | 9336712..9336933 | 422..643 | 100 | -> | Plus |
3L | 9336998..9337221 | 644..867 | 100 | -> | Plus |
3L | 9337726..9337936 | 1075..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9337454..9337660 | 868..1074 | 100 | -> | Plus |
3L | 9334333..9334435 | 1..103 | 100 | -> | Plus |
3L | 9334610..9334927 | 104..421 | 100 | -> | Plus |
3L | 9336712..9336933 | 422..643 | 100 | -> | Plus |
3L | 9336998..9337221 | 644..867 | 100 | -> | Plus |
3L | 9337726..9337936 | 1075..1285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 9330554..9330760 | 868..1074 | 100 | -> | Plus |
arm_3L | 9330826..9331036 | 1075..1285 | 100 | Plus | |
arm_3L | 9330098..9330321 | 644..867 | 100 | -> | Plus |
arm_3L | 9327433..9327535 | 1..103 | 100 | -> | Plus |
arm_3L | 9327710..9328027 | 104..421 | 100 | -> | Plus |
arm_3L | 9329812..9330033 | 422..643 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9327433..9327535 | 1..103 | 100 | -> | Plus |
3L | 9327710..9328027 | 104..421 | 100 | -> | Plus |
3L | 9329812..9330033 | 422..643 | 100 | -> | Plus |
3L | 9330098..9330321 | 644..867 | 100 | -> | Plus |
3L | 9330554..9330760 | 868..1074 | 100 | -> | Plus |
3L | 9330826..9331036 | 1075..1285 | 100 | Plus |
Translation from 123 to 644
> GH18280.hyp MFEENNSPTTDNSLWTLQGRQRASPAQRLHNLTSAGSSTSSSGLPLPQNI FTNPAIQPSSVINLNHSTDVVIGPMTQYQGPVSIYYMDYMEAHAMQTAAG INSNNANGNGNANRSRDKSPSRRVTRNTILLITLILLVLATGLIVLYVEL NRPKPELPSNKAIYFGNNYDHQT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
PGRP-LA-PD | 173 | CG32042-PD | 1..173 | 1..173 | 893 | 100 | Plus |
PGRP-LA-PE | 368 | CG32042-PE | 1..173 | 1..173 | 893 | 100 | Plus |
PGRP-LA-PF | 299 | CG32042-PF | 24..104 | 92..173 | 373 | 91.5 | Plus |
Translation from 123 to 644
> GH18280.pep MFEENNSPTTDNSLWTLQGRQRASPAQRLHNLTSAGSSTSSSGLPLPQNI FTNPAIQPSSVINLNHSTDVVIGPMTQYQGPVSIYYMDYMEAHAMQTAAG INSNNANGNGNANRSRDKSPSRRVTRNTILLITLILLVLATGLIVLYVEL NRPKPELPSNKAIYFGNNYDHQT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10679-PA | 391 | GF10679-PA | 1..196 | 1..173 | 673 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15354-PA | 103 | GG15354-PA | 1..103 | 1..101 | 442 | 88.3 | Plus |
Dere\GG15355-PA | 299 | GG15355-PA | 45..104 | 114..173 | 235 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
PGRP-LA-PD | 173 | CG32042-PD | 1..173 | 1..173 | 893 | 100 | Plus |
PGRP-LA-PE | 368 | CG32042-PE | 1..173 | 1..173 | 893 | 100 | Plus |
PGRP-LA-PF | 299 | CG32042-PF | 24..104 | 92..173 | 373 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12107-PA | 418 | GI12107-PA | 14..223 | 9..173 | 266 | 39.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA29293-PA | 113 | GA29293-PA | 1..113 | 1..104 | 318 | 63.7 | Plus |
Dpse\GA29294-PA | 291 | GA29294-PA | 44..96 | 120..173 | 147 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25128-PA | 368 | GM25128-PA | 1..173 | 1..173 | 884 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\PGRP-LA-PA | 368 | GD14165-PA | 1..173 | 1..173 | 885 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13381-PA | 128 | GJ13381-PA | 14..96 | 11..99 | 268 | 66.3 | Plus |