Clone GH18521 Report

Search the DGRC for GH18521

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:185
Well:21
Vector:pOT2
Associated Gene/TranscriptCG8838-RA
Protein status:GH18521.pep: gold
Preliminary Size:1148
Sequenced Size:954

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8838 2001-01-01 Release 2 assignment
CG8838 2002-06-12 Blastp of sequenced clone
CG8838 2003-01-01 Sim4 clustering to Release 3
CG8838 2008-04-29 Release 5.5 accounting
CG8838 2008-08-15 Release 5.9 accounting
CG8838 2008-12-18 5.12 accounting

Clone Sequence Records

GH18521.complete Sequence

954 bp (954 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122118

> GH18521.complete
CCCCATTACACATTTATCACTAAACATTCAAAGAATTTTCCAAACTTTTA
CTCTGTTTTAAACACGATGACGTCCATGCTGAATACCCCGATAGTCTCCA
TCTTCGATTTGATGGTGGAACGTCACATCAGGCTGCGCAGGGAACTGAAT
GGAAATCTTCCGCCAGTTCGTCGGCCTAAAGCAGCACGTGGAGCTGCCGA
CGGAAAGAAACCTTTCAAATACAAACCAAGTCCGATGGAGTTTCCCTTGC
CAGAAACACTGGAATTGATGTCTCCGCCAGCGGCAAATGCCATTACTGCC
GCGCATTTGACCCAGAAACACACTTTCCTTAAGATCCAGCCACCGAGCGA
GAAGAACGCAATTAAGAAGCTGGTGGAGAAGATGTCCCATGGACGAGGCA
AGACCAAGACCGTGTCGCCAAGGCACTCCCTGTCCAGCAAGAAGACCAGT
GCCAATTCCTCCAAGACGGTCGTCATTCAGCCTCGCAAAAGGAAAGTAGC
CGGGCAGGGATCATTCCGTGCTCAGCCAAAGCTCGGCAAGACCAGTTCCA
CTCAGTTGAAGCGACAACCCCTCTCTCCCAGAAGGGCAGAATCTACAGCT
AAGGATGCCAGTACGCTGAGCAAGACGAAGACCAAGAAGAGTTCGCCTGA
AAAGTCGGGTGCACAGATGCGAAATACCAGGTCTGCAGATCGACTCGGCA
ATGCAGAGATTCCGGTCTCAAAACGATGGCGTCTTTAGAAGCGATAGATA
TACCAGTAGATTTTCATTCATTCAAGCTAATCAAATTTGCACCAAGTAAT
CAACAACTTTAATCACAGTGATCCCTCCATGTGATGGACCGCACTGAATC
CCACATGAAGGCGATCCAAATTGAAAATGTACTTAAATATGGATTGTCTA
GTTTATATACACATGAATAAAAATGTCATGAAATGAAAAAAAAAAAAAAA
AAAA

GH18521.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG8838-RA 935 CG8838-RA 1..935 1..935 4675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3357317..3358251 1..935 4585 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3357684..3358625 1..942 4695 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3357684..3358625 1..942 4695 99.8 Plus
Blast to na_te.dros performed on 2019-03-15 19:22:54 has no hits.

GH18521.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:23:47 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3357317..3358251 1..935 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:08 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..672 67..738 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:27 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..672 67..738 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:48:56 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..672 67..738 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:14:08 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..672 67..738 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:16:03 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..672 67..738 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:33 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:26 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:48:56 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 39..973 1..935 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:14:09 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 1..935 1..935 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:16:03 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
CG8838-RA 39..973 1..935 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:23:47 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3357684..3358618 1..935 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:23:47 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3357684..3358618 1..935 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:23:47 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3357684..3358618 1..935 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:48:56 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3357684..3358618 1..935 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:47:03 Download gff for GH18521.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3357684..3358618 1..935 100   Plus

GH18521.hyp Sequence

Translation from 0 to 737

> GH18521.hyp
PHYTFITKHSKNFPNFYSVLNTMTSMLNTPIVSIFDLMVERHIRLRRELN
GNLPPVRRPKAARGAADGKKPFKYKPSPMEFPLPETLELMSPPAANAITA
AHLTQKHTFLKIQPPSEKNAIKKLVEKMSHGRGKTKTVSPRHSLSSKKTS
ANSSKTVVIQPRKRKVAGQGSFRAQPKLGKTSSTQLKRQPLSPRRAESTA
KDASTLSKTKTKKSSPEKSGAQMRNTRSADRLGNAEIPVSKRWRL*

GH18521.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG8838-PA 223 CG8838-PA 1..223 23..245 1126 100 Plus

GH18521.pep Sequence

Translation from 66 to 737

> GH18521.pep
MTSMLNTPIVSIFDLMVERHIRLRRELNGNLPPVRRPKAARGAADGKKPF
KYKPSPMEFPLPETLELMSPPAANAITAAHLTQKHTFLKIQPPSEKNAIK
KLVEKMSHGRGKTKTVSPRHSLSSKKTSANSSKTVVIQPRKRKVAGQGSF
RAQPKLGKTSSTQLKRQPLSPRRAESTAKDASTLSKTKTKKSSPEKSGAQ
MRNTRSADRLGNAEIPVSKRWRL*

GH18521.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14181-PA 234 GF14181-PA 1..234 1..223 188 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24935-PA 222 GG24935-PA 1..222 1..223 666 67.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8838-PA 223 CG8838-PA 1..223 1..223 1126 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18412-PA 226 GM18412-PA 1..226 1..223 816 82.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23224-PA 229 GD23224-PA 1..229 1..223 820 82.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18227-PA 228 GE18227-PA 1..228 1..223 761 75.1 Plus