Clone GH18546 Report

Search the DGRC for GH18546

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:185
Well:46
Vector:pOT2
Associated Gene/TranscriptCG5955-RA
Protein status:GH18546.pep: gold
Preliminary Size:1470
Sequenced Size:1308

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5955 2001-01-01 Release 2 assignment
CG5955 2001-09-19 Blastp of sequenced clone
CG5955 2003-01-01 Sim4 clustering to Release 3
CG5955 2008-04-29 Release 5.5 accounting
CG5955 2008-08-15 Release 5.9 accounting
CG5955 2008-12-18 5.12 accounting

Clone Sequence Records

GH18546.complete Sequence

1308 bp (1308 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058410

> GH18546.complete
CTGGCAGCGCTCGTCGCGAATCGAAAAAGTCCAGTTCGCAAAATGTTTCG
CAAATGCCTCGCCAGCCTGGCTTTGGCCCCAGTTGCCAGTCCCATTCCGC
TGCCCAGGATCACCCCGATCGCCAGCCAGCTTGTCCAGCGTCGCGCGTTC
CACCAGGTTCCTCGCGAGAGTAGGCCACCCAAAATTCTGATCACAGGTGG
CTTGGGCCAGTTGGGCATCGAGTGCGCCAAACTCCTGCGGACGCAGTATG
GCAGCCAAAACGTGATCCTCTCGGACATTATAAAGCCCAGTCAGTCGGTA
CTGGAGAATGGTCCCTACATTTTTGCCGACATCCTGGACTTCAAGGGTCT
CCAGAAGATCGTTGTGGACCATCGCATTGACTGGCTGATCCATTTCTCGG
CCCTGCTGAGTGCGGTGGGAGAGCAAAATGTTCCACTGGCTGTGAGGGTC
AACATCGAGGGTGTCCACAACGTCATCGAGCTGGCGAAGCAGTATAAGCT
CCGCATCTTCGTACCAAGCACAATCGGAGCCTTCGGTCCCGACAGTCCTC
GCAATCCCACGCCGAATGTTACGATCCAACGGCCGCGCACCATTTACGGC
GTTTCCAAGGTGCACGCCGAGCTGATTGGCGAATACTACTACCACAAGTT
TGGACTGGACTTCAGATGCCTGCGCTTCCCAGGAGTGATTTCCAGTGATC
CGCCGGGCGGCGGCACCACAGATTACGCTGTGGCCGTGTTCCATGAAGCG
CTGCGCAATGGAAAGTACACCTGCTACCTGCGTCCTGACACAAGACTGCC
CATGATGTACATTGAAGATTGTTTGCGGGCTCTCCTCGAGTTCATGCGTG
CTCCCAACGAACAGCTGAAGCGCCGCGTCTACAACGTGACCGCCATGTCC
TTCACTCCCGAGGAGCTGTTCGCCCAGCTGGGCAAGCACGTGCCCAATCT
GCACGTGACCTACAAGCCAGATAGCCGCCAGTTGATCGCAGACGCCTGGC
CGCAGGTATTCGATGACTCCGATGCGCGGCGCGACTGGCACTGGCAGCAC
AAGTACGACCTGTCCAACCTGGTGGACTTCATGATCAAGGACGTGCAGGA
TAACTACATTAATGTTCAGCCGGAGCAGCAGACTCTGCAGATCTAAGACG
TGGATCGAACAACCGCATCTAGTATTGCTAAGTAATGAAATCCAATCGCA
TTTAACACTGCATTTATCTAGTGAATAGCAACACAAACCACTGTAACATT
TTACCTTTTAAAATACAGTAAGGCATTTATTGGAAAGGAAAAAAAAAAAA
AAAAAAAA

GH18546.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5955-RA 1344 CG5955-RA 47..1338 1..1292 6460 100 Plus
CG32428.a 1495 CG32428.a 1439..1495 1292..1236 285 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20458140..20458601 827..1288 2295 99.8 Plus
chr3L 24539361 chr3L 20456725..20456978 194..447 1255 99.6 Plus
chr3L 24539361 chr3L 20455978..20456175 1..198 990 100 Plus
chr3L 24539361 chr3L 20457321..20457469 573..721 745 100 Plus
chr3L 24539361 chr3L 20457134..20457262 445..573 645 100 Plus
chr3L 24539361 chr3L 20457973..20458081 720..828 530 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20469131..20469596 827..1292 2330 100 Plus
3L 28110227 3L 20467716..20467969 194..447 1270 100 Plus
3L 28110227 3L 20466970..20467167 1..198 990 100 Plus
3L 28110227 3L 20468312..20468460 573..721 745 100 Plus
3L 28110227 3L 20468125..20468253 445..573 645 100 Plus
3L 28110227 3L 20468964..20469072 720..828 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20462231..20462696 827..1292 2330 100 Plus
3L 28103327 3L 20460816..20461069 194..447 1270 100 Plus
3L 28103327 3L 20460070..20460267 1..198 990 100 Plus
3L 28103327 3L 20461412..20461560 573..721 745 100 Plus
3L 28103327 3L 20461225..20461353 445..573 645 100 Plus
3L 28103327 3L 20462064..20462172 720..828 545 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:56:04 has no hits.

GH18546.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:56:44 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20455978..20456173 1..196 100 -> Plus
chr3L 20456728..20456977 197..446 99 -> Plus
chr3L 20457136..20457262 447..573 100 -> Plus
chr3L 20457322..20457469 574..721 100 -> Plus
chr3L 20457975..20458080 722..827 99 -> Plus
chr3L 20458141..20458601 828..1288 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:09 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 1..1104 43..1146 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:06:39 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 1..1104 43..1146 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:25 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 1..1104 43..1146 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:37:26 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 1..1104 43..1146 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:51:47 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 1..1104 43..1146 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:56:29 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 23..1310 1..1288 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:06:38 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 23..1310 1..1288 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:25 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 27..1314 1..1288 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:37:26 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 23..1310 1..1288 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:51:47 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
CG5955-RA 27..1314 1..1288 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:44 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20466970..20467165 1..196 100 -> Plus
3L 20467719..20467968 197..446 100 -> Plus
3L 20468127..20468253 447..573 100 -> Plus
3L 20468313..20468460 574..721 100 -> Plus
3L 20468966..20469071 722..827 100 -> Plus
3L 20469132..20469592 828..1288 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:44 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20466970..20467165 1..196 100 -> Plus
3L 20467719..20467968 197..446 100 -> Plus
3L 20468127..20468253 447..573 100 -> Plus
3L 20468313..20468460 574..721 100 -> Plus
3L 20468966..20469071 722..827 100 -> Plus
3L 20469132..20469592 828..1288 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:56:44 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20466970..20467165 1..196 100 -> Plus
3L 20467719..20467968 197..446 100 -> Plus
3L 20468127..20468253 447..573 100 -> Plus
3L 20468313..20468460 574..721 100 -> Plus
3L 20468966..20469071 722..827 100 -> Plus
3L 20469132..20469592 828..1288 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:25 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20460070..20460265 1..196 100 -> Plus
arm_3L 20460819..20461068 197..446 100 -> Plus
arm_3L 20461227..20461353 447..573 100 -> Plus
arm_3L 20461413..20461560 574..721 100 -> Plus
arm_3L 20462066..20462171 722..827 100 -> Plus
arm_3L 20462232..20462692 828..1288 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:14:36 Download gff for GH18546.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20460070..20460265 1..196 100 -> Plus
3L 20460819..20461068 197..446 100 -> Plus
3L 20461227..20461353 447..573 100 -> Plus
3L 20461413..20461560 574..721 100 -> Plus
3L 20462066..20462171 722..827 100 -> Plus
3L 20462232..20462692 828..1288 100   Plus

GH18546.hyp Sequence

Translation from 0 to 1145

> GH18546.hyp
LAALVANRKSPVRKMFRKCLASLALAPVASPIPLPRITPIASQLVQRRAF
HQVPRESRPPKILITGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSV
LENGPYIFADILDFKGLQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRV
NIEGVHNVIELAKQYKLRIFVPSTIGAFGPDSPRNPTPNVTIQRPRTIYG
VSKVHAELIGEYYYHKFGLDFRCLRFPGVISSDPPGGGTTDYAVAVFHEA
LRNGKYTCYLRPDTRLPMMYIEDCLRALLEFMRAPNEQLKRRVYNVTAMS
FTPEELFAQLGKHVPNLHVTYKPDSRQLIADAWPQVFDDSDARRDWHWQH
KYDLSNLVDFMIKDVQDNYINVQPEQQTLQI*

GH18546.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5955-PA 367 CG5955-PA 1..367 15..381 1934 100 Plus

GH18546.pep Sequence

Translation from 42 to 1145

> GH18546.pep
MFRKCLASLALAPVASPIPLPRITPIASQLVQRRAFHQVPRESRPPKILI
TGGLGQLGIECAKLLRTQYGSQNVILSDIIKPSQSVLENGPYIFADILDF
KGLQKIVVDHRIDWLIHFSALLSAVGEQNVPLAVRVNIEGVHNVIELAKQ
YKLRIFVPSTIGAFGPDSPRNPTPNVTIQRPRTIYGVSKVHAELIGEYYY
HKFGLDFRCLRFPGVISSDPPGGGTTDYAVAVFHEALRNGKYTCYLRPDT
RLPMMYIEDCLRALLEFMRAPNEQLKRRVYNVTAMSFTPEELFAQLGKHV
PNLHVTYKPDSRQLIADAWPQVFDDSDARRDWHWQHKYDLSNLVDFMIKD
VQDNYINVQPEQQTLQI*

GH18546.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10346-PA 371 GF10346-PA 1..370 1..367 1727 87.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16117-PA 367 GG16117-PA 1..367 1..367 1919 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14551-PA 350 GH14551-PA 1..344 1..357 1633 85.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5955-PA 367 CG5955-PA 1..367 1..367 1934 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13398-PA 355 GI13398-PA 1..355 1..367 1660 86.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12790-PA 365 GL12790-PA 1..363 1..367 1726 87.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19257-PA 365 GA19257-PA 1..363 1..367 1738 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:55:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22296-PA 367 GM22296-PA 1..367 1..367 1943 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14889-PA 367 GD14889-PA 1..367 1..367 1949 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11523-PA 359 GJ11523-PA 1..359 1..367 1661 85.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12293-PA 370 GK12293-PA 1..370 1..367 1728 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19685-PA 369 GE19685-PA 1..369 1..367 1902 96.7 Plus
Dyak\GE23237-PA 369 GE23237-PA 1..369 1..367 1899 96.5 Plus