Clone GH18574 Report

Search the DGRC for GH18574

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:185
Well:74
Vector:pOT2
Associated Gene/TranscriptCG42676-RA
Protein status:GH18574.pep: wuzgold
Preliminary Size:1595
Sequenced Size:1582

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12022 2001-01-01 Release 2 assignment
CG12022 2001-07-04 Blastp of sequenced clone
CG32317 2003-01-01 Sim4 clustering to Release 3
CG12022 2008-04-29 Release 5.5 accounting
CG12022 2008-08-15 Release 5.9 accounting
CG13923 2008-08-15 Release 5.9 accounting
CG12022 2008-12-18 5.12 accounting
CG13923 2008-12-18 5.12 accounting

Clone Sequence Records

GH18574.complete Sequence

1582 bp (1582 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051532

> GH18574.complete
CAATTACGGAGGACAAGCACAAAGCGGACTTGAGAAATTTGTGAAAATTT
TTATAAATCGCGTGTGTGGGCGCTTTGAAAATGGTGCTGCGATCGGGAAT
CATAATTCCGTTTCAGTTTCGCGACACGAAGAAGCTGCTGATGATCGGGG
TGCCGCAGGAGAACCGCGACCTAAACATATGGGACCTAAAGAACGTGGTG
CGCGCCGCCTTCGGGATCTACAACTTCGAGTTCCGGAACAAGAAGATCGG
CTTCAACATCCCGGACGAACTGCTGCTGCACTATCTGGCCCAGAGGCACG
ACCTCACCAACTTCGTTATAGAGATCAGTCAAGGTAAATAGCGTTTAAGT
TACGGCTAAGTCGCGTTTCAATTAGCGTTTAAGCGTTCGAGTGACTGCGG
GCCACCAAAAGTCGCGATTTCGCGGAGTTCCGGAGTTTCACAGTCAAGTC
TTGTTTGTAGATCAGTTGTGTTTATGTAGACGATGCGTGCGCTTCGCTTC
TCTGGACGATGGCCACGCCAAGGAGATGCTCTCCTACGAGCCCTCATGCT
CGATGGCGGTCCTGAAGCACCACCCTCATCAGCACCAGCACCACGTGCCT
CTGCCGCAGCGGTCAAACGAAAGCGCCTCGCACCACGCCCATGAATATGT
GCCTGACTCCCAGCCCACCTCTCCGGCCCTACGTATGAGTTCTGAGGCGG
TGGACTCGCCACTGGACCAGCAGGGCAACAACTCGGTGCCGGAACGCACG
GATAGTTCCCACAAACTGCGCCTGGGGCAGGCTTACTCGGAACGGACGCC
GGAATCGATGACCCAGGCCATTGACCCCATGGATATTATACCCAAGTCGG
AGTCCGAATCGGAGGTGGAACGTCTGCAGCGGGCCTCCAGATTCCTAGCG
CGCCAGGAACAGCACCAAGCCCAGCAGCAACAGCACCAGCAGCAGTTGCT
GCCCGGTCAGCAGATCTTCCCCAGCTACACGCATCCTTTGCCGTCGATGA
ATGCACCAAATACCTCCCAACAGTCGCCTTACACACCGGGTCTGATGAGT
CGCTTTAGAAAACGCGGCGAACGCATGTCCAAGGACCAAAAGGAGCTGTA
CGTTAAGTTTTTCGAGGACAATCCATGCATGCTATCAAACCACCGCCGGC
ACGATGGCCTCACTGAACCATTGTGGGCAAAATTGGCCCACATGCTGAAT
AGTGTTCCCCAAGGCGCCGTAAAGAACGTAGAGGACTGGAAGCAGACCTT
TGACGCCTGGCGGTACCGCATCTTCATGTACACACGCTACAACTCCAAGC
TCAGCATGTCGGAAACGACCGATCCGAAGAACTTCAAGCCCCTGACAGCT
ACCGACCAGAAGGCGTATGCCATGTGGACCAGCCACAAGCACATAACGCC
GCAGGACTACGAAAAAATGGACATGTTCGTGCCGCTGGACGAGACCACCA
CGGCAACGAACACCTACGACTACTAAATCGAGATCAAAGTGCAAAATATA
AAACTGTTAATGTGTACTTTAACTATTGCTAAGAAATAGAATACTTTTTA
AGAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH18574.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG12022-RA 1554 CG12022-RA 1..1554 1..1554 7770 100 Plus
CG12022.a 1391 CG12022.a 330..1391 500..1561 5295 99.9 Plus
CG13923-RB 1585 CG13923-RB 42..374 1..333 1665 100 Plus
CG12022.a 1391 CG12022.a 1..329 1..333 1580 98.7 Plus
CG13923-RB 1585 CG13923-RB 1122..1239 1184..1301 185 77.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1803355..1803915 500..1060 2805 100 Plus
chr3L 24539361 chr3L 1803977..1804470 1061..1554 2470 100 Plus
chr3L 24539361 chr3L 1802992..1803293 198..499 1510 100 Plus
chr3L 24539361 chr3L 1802690..1802887 1..198 990 100 Plus
chr3L 24539361 chr3L 1805916..1806033 1184..1301 185 77.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1803795..1804355 500..1060 2805 100 Plus
3L 28110227 3L 1804417..1804917 1061..1561 2490 99.8 Plus
3L 28110227 3L 1803432..1803733 198..499 1510 100 Plus
3L 28110227 3L 1803130..1803327 1..198 990 100 Plus
3L 28110227 3L 1806356..1806473 1184..1301 185 77.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1803795..1804355 500..1060 2805 100 Plus
3L 28103327 3L 1804417..1804917 1061..1561 2490 99.8 Plus
3L 28103327 3L 1803432..1803733 198..499 1510 100 Plus
3L 28103327 3L 1803130..1803327 1..198 990 100 Plus
3L 28103327 3L 1806356..1806473 1184..1301 185 77.1 Plus
Blast to na_te.dros performed 2019-03-16 23:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2781..2849 895..963 174 72.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6811..6856 900..945 158 82.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6819 900..962 153 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6736..6785 900..949 151 78 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6778..6823 900..945 149 80.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2305..2383 902..979 149 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1506..1565 883..945 137 71.4 Plus
roo 9092 roo DM_ROO 9092bp 1110..1149 905..944 137 82.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6790..6865 900..974 134 65.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1541..1586 900..945 131 76.1 Plus
invader4 3105 invader4 INVADER4 3105bp 81..135 621..567 131 70.9 Minus
invader4 3105 invader4 INVADER4 3105bp 2840..2894 621..567 131 70.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2336..2380 900..944 126 75.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2351..2431 900..979 123 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6795 908..979 120 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2446..2518 908..979 119 64.4 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7943..8022 910..985 119 66.2 Plus
TART-C 11124 TART-C TARTC 11124bp 9387..9466 910..985 119 66.2 Plus
roo 9092 roo DM_ROO 9092bp 1072..1134 900..962 117 65.1 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 95..196 868..963 117 63.1 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9125..9226 868..963 117 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2765..2825 903..963 116 65.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2390..2470 900..979 114 61.7 Plus
roo 9092 roo DM_ROO 9092bp 1117..1164 900..947 114 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2616..2659 901..944 112 72.7 Plus

GH18574.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:40:46 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1802690..1802887 1..198 100 -> Plus
chr3L 1802993..1803293 199..499 100 -> Plus
chr3L 1803355..1803915 500..1060 100 -> Plus
chr3L 1803977..1804470 1061..1554 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:10 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG12022-RA 1..951 526..1476 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:25:42 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG42676-RC 1..253 81..333 100 == Plus
CG42676-RC 254..1230 500..1476 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:30 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG42676-RC 1..253 81..333 100 == Plus
CG42676-RC 254..1230 500..1476 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:58:43 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG12022-RA 1..951 526..1476 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:54:21 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG42676-RC 1..253 81..333 100 == Plus
CG42676-RC 254..1230 500..1476 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:24:20 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG12022-RA 1..1554 1..1554 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:25:42 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG42676-RA 12..1565 1..1554 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:30 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG42676-RE 24..1577 1..1554 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:58:43 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG12022-RA 1..1554 1..1554 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:54:21 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
CG42676-RE 24..1577 1..1554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:40:46 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1803130..1803327 1..198 100 -> Plus
3L 1803433..1803733 199..499 100 -> Plus
3L 1803795..1804355 500..1060 100 -> Plus
3L 1804417..1804910 1061..1554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:40:46 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1803130..1803327 1..198 100 -> Plus
3L 1803433..1803733 199..499 100 -> Plus
3L 1803795..1804355 500..1060 100 -> Plus
3L 1804417..1804910 1061..1554 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:40:46 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1803130..1803327 1..198 100 -> Plus
3L 1803433..1803733 199..499 100 -> Plus
3L 1803795..1804355 500..1060 100 -> Plus
3L 1804417..1804910 1061..1554 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:30 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1803130..1803327 1..198 100 -> Plus
arm_3L 1803433..1803733 199..499 100 -> Plus
arm_3L 1803795..1804355 500..1060 100 -> Plus
arm_3L 1804417..1804910 1061..1554 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:36:32 Download gff for GH18574.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1803433..1803733 199..499 100 -> Plus
3L 1803795..1804355 500..1060 100 -> Plus
3L 1804417..1804910 1061..1554 100   Plus
3L 1803130..1803327 1..198 100 -> Plus

GH18574.pep Sequence

Translation from 525 to 1475

> GH18574.pep
MLSYEPSCSMAVLKHHPHQHQHHVPLPQRSNESASHHAHEYVPDSQPTSP
ALRMSSEAVDSPLDQQGNNSVPERTDSSHKLRLGQAYSERTPESMTQAID
PMDIIPKSESESEVERLQRASRFLARQEQHQAQQQQHQQQLLPGQQIFPS
YTHPLPSMNAPNTSQQSPYTPGLMSRFRKRGERMSKDQKELYVKFFEDNP
CMLSNHRRHDGLTEPLWAKLAHMLNSVPQGAVKNVEDWKQTFDAWRYRIF
MYTRYNSKLSMSETTDPKNFKPLTATDQKAYAMWTSHKHITPQDYEKMDM
FVPLDETTTATNTYDY*

GH18574.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24840-PA 746 GF24840-PA 94..396 1..287 1146 77.7 Plus
Dana\GF24840-PA 746 GF24840-PA 611..743 177..309 395 54.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14828-PA 409 GG14828-PA 94..409 1..316 1471 93.7 Plus
Dere\GG14829-PA 316 GG14829-PA 181..313 177..309 391 54.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16436-PA 445 GH16436-PA 94..445 1..316 1163 71.5 Plus
Dgri\GH16437-PA 359 GH16437-PA 222..356 175..309 402 55.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG42676-PC 409 CG42676-PC 94..409 1..316 1699 100 Plus
CG42676-PF 427 CG42676-PF 144..422 15..307 426 37 Plus
CG42676-PD 427 CG13923-PB 144..422 15..307 426 37 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12520-PA 441 GI12520-PA 94..441 1..316 1202 73.1 Plus
Dmoj\GI12521-PA 367 GI12521-PA 225..364 170..309 405 53.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25308-PA 391 GL25308-PA 60..391 1..316 1307 79.5 Plus
Dper\GL25310-PA 360 GL25310-PA 223..356 175..308 403 55.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23753-PA 423 GA23753-PA 94..423 1..316 1319 80.6 Plus
Dpse\GA23754-PA 354 GA23754-PA 217..350 175..308 403 55.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14450-PA 409 GM14450-PA 94..409 1..316 1658 97.2 Plus
Dsec\GM14451-PA 320 GM14451-PA 183..317 175..309 392 53.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13650-PA 409 GD13650-PA 94..409 1..316 1652 96.8 Plus
Dsim\GD13651-PA 323 GD13651-PA 186..320 175..309 391 53.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12424-PA 438 GJ12424-PA 94..438 1..316 1224 73.2 Plus
Dvir\GJ12425-PA 349 GJ12425-PA 212..346 175..309 401 55.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20330-PA 814 GK20330-PA 94..441 1..315 1216 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21191-PA 409 GE21191-PA 94..409 1..316 1468 95.9 Plus
Dyak\GE21192-PA 319 GE21192-PA 182..316 175..309 397 54.4 Plus

GH18574.hyp Sequence

Translation from 525 to 1475

> GH18574.hyp
MLSYEPSCSMAVLKHHPHQHQHHVPLPQRSNESASHHAHEYVPDSQPTSP
ALRMSSEAVDSPLDQQGNNSVPERTDSSHKLRLGQAYSERTPESMTQAID
PMDIIPKSESESEVERLQRASRFLARQEQHQAQQQQHQQQLLPGQQIFPS
YTHPLPSMNAPNTSQQSPYTPGLMSRFRKRGERMSKDQKELYVKFFEDNP
CMLSNHRRHDGLTEPLWAKLAHMLNSVPQGAVKNVEDWKQTFDAWRYRIF
MYTRYNSKLSMSETTDPKNFKPLTATDQKAYAMWTSHKHITPQDYEKMDM
FVPLDETTTATNTYDY*

GH18574.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42676-PC 409 CG42676-PC 94..409 1..316 1699 100 Plus
CG42676-PF 427 CG42676-PF 144..422 15..307 426 37 Plus
CG42676-PD 427 CG13923-PB 144..422 15..307 426 37 Plus