Clone GH18902 Report

Search the DGRC for GH18902

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:189
Well:2
Vector:pOT2
Associated Gene/TranscriptCG4951-RA
Protein status:GH18902.pep: gold
Preliminary Size:1243
Sequenced Size:1062

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4951 2001-01-01 Release 2 assignment
CG4951 2003-01-01 Sim4 clustering to Release 3
CG4951 2003-01-15 Blastp of sequenced clone
CG4951 2008-04-29 Release 5.5 accounting
CG4951 2008-08-15 Release 5.9 accounting
CG4951 2008-12-18 5.12 accounting

Clone Sequence Records

GH18902.complete Sequence

1062 bp (1062 high quality bases) assembled on 2003-01-15

GenBank Submission: AY060739

> GH18902.complete
CTACGGTCACATCAGGACGCATAGCAATTTTATAAAAATGTCATTTTCCG
CCATCGGTGATTGCCAACTAATTTCGCAATTATACCAGTACAAGAAGCAC
CGCGTCATCTGCAGCGTCAAAGTTCTGCCGACACCTGTGACCCATTTTGA
GCGGGAATCCAAGAATGATTTCCATTGGATGACCGCGGATCGGTGGAGCC
GGATTGAGTGTGGTCTATGGCGCCTGTTCGAGAACCTGAAGCAGTGGCAG
GATGCCTACCAACTGGACACCGAGCTCATTATCGATCACATCATCGTGCG
CGTCCAGGCGACCAATAAGTCGCATCCTGCAACGGTCGCTCTTCTGGCCG
GTACGGAGTCCAGCTCCAAGGATCTCTGCCTGGACCTACAGCTGCAGTAC
ATAACACAAGAGGACACCACCATTGTGGACGTCATTCCCGCCAAGCGCGA
GCTTGCCACGGAAGCAGAAACAAATGGCACCAGACCCACATCCCGCAAGA
TCCGCGTAGCAAACTCAGGATCCAAGCCAAAAGCGGGCACACAATCGAAG
CCCAAGCACATTGACGCCGACAACGAGGATGACAAGAGCTCCACCACGGC
CAGCCAACCAACCAAGATCAAGAGCGAGCGCAGGTCCATTTCCCAAGGAG
GCGAAAAGGATAAGGCTTCTTCCAGCAGCCCCAGTTCCTCGCAGCAGAGC
AACCGCATTAAGCGATCGCACAGTCCATCACAGCAGAATTCCAGATCCAG
CTCCGTTGAGGCCAAGCCTGCACGCCGCTCCGGCCGATCGCCCATACGCC
CGAGTCGATTCAAAAACTTCGTAGTTGGCGAGACCAGGAGCGGCAAGAGC
AGAGGACCCAAGCCCAAAGTGAAACGAGTATCGCCAGTGCCGGCCAAAGA
TTTCAAGGTGGAACACATGGACGGAGGGCGGTTCAATGCATTGCAGCGGC
TGGACAGCATGCTGGACACGCCCAAGCCGCGCGAGGTTAAGATTTTGTAA
GTGACTCGACTAGATGCAAATAAAGCGAACACGAATGTGCCTTCAAAAAA
AAAAAAAAAAAA

GH18902.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4951-RA 1344 CG4951-RA 294..1339 1..1046 5230 100 Plus
CG4951.b 1344 CG4951.b 294..1339 1..1046 5230 100 Plus
CG4951.d 2271 CG4951.d 704..1699 1..996 4980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23776460..23776911 537..86 2260 100 Minus
chr3R 27901430 chr3R 23775671..23775887 1044..828 1070 99.5 Minus
chr3R 27901430 chr3R 23776105..23776304 736..537 1000 100 Minus
chr3R 27901430 chr3R 23775955..23776047 828..736 450 98.9 Minus
chr3R 27901430 chr3R 23776964..23777051 88..1 440 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27953498..27953949 537..86 2260 100 Minus
3R 32079331 3R 27952707..27952925 1046..828 1095 100 Minus
3R 32079331 3R 27953143..27953342 736..537 1000 100 Minus
3R 32079331 3R 27952993..27953085 828..736 465 100 Minus
3R 32079331 3R 27954002..27954089 88..1 440 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27694329..27694780 537..86 2260 100 Minus
3R 31820162 3R 27693538..27693756 1046..828 1095 100 Minus
3R 31820162 3R 27693974..27694173 736..537 1000 100 Minus
3R 31820162 3R 27693824..27693916 828..736 465 100 Minus
3R 31820162 3R 27694833..27694920 88..1 440 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:44:54 has no hits.

GH18902.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:46:07 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23776106..23776303 538..735 100 <- Minus
chr3R 23775671..23775886 829..1044 99 <- Minus
chr3R 23775955..23776047 736..828 98 <- Minus
chr3R 23776460..23776908 89..537 100 <- Minus
chr3R 23776964..23777051 1..88 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:34 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 1..963 38..1000 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:22 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 1..963 38..1000 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:48 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 1..963 38..1000 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:18 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 1..963 38..1000 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:36 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 1..963 38..1000 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:04 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 24..1067 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:21 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 24..1067 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:48 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 24..1067 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:18 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 24..1067 1..1044 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:36 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
CG4951-RA 24..1067 1..1044 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:07 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27952709..27952924 829..1044 100 <- Minus
3R 27952993..27953085 736..828 100 <- Minus
3R 27953144..27953341 538..735 100 <- Minus
3R 27953498..27953946 89..537 100 <- Minus
3R 27954002..27954089 1..88 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:07 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27952709..27952924 829..1044 100 <- Minus
3R 27952993..27953085 736..828 100 <- Minus
3R 27953144..27953341 538..735 100 <- Minus
3R 27953498..27953946 89..537 100 <- Minus
3R 27954002..27954089 1..88 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:07 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27952709..27952924 829..1044 100 <- Minus
3R 27952993..27953085 736..828 100 <- Minus
3R 27953144..27953341 538..735 100 <- Minus
3R 27953498..27953946 89..537 100 <- Minus
3R 27954002..27954089 1..88 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:48 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23778431..23778646 829..1044 100 <- Minus
arm_3R 23778715..23778807 736..828 100 <- Minus
arm_3R 23778866..23779063 538..735 100 <- Minus
arm_3R 23779220..23779668 89..537 100 <- Minus
arm_3R 23779724..23779811 1..88 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:31 Download gff for GH18902.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27693540..27693755 829..1044 100 <- Minus
3R 27693824..27693916 736..828 100 <- Minus
3R 27693975..27694172 538..735 100 <- Minus
3R 27694329..27694777 89..537 100 <- Minus
3R 27694833..27694920 1..88 100   Minus

GH18902.hyp Sequence

Translation from 0 to 999

> GH18902.hyp
YGHIRTHSNFIKMSFSAIGDCQLISQLYQYKKHRVICSVKVLPTPVTHFE
RESKNDFHWMTADRWSRIECGLWRLFENLKQWQDAYQLDTELIIDHIIVR
VQATNKSHPATVALLAGTESSSKDLCLDLQLQYITQEDTTIVDVIPAKRE
LATEAETNGTRPTSRKIRVANSGSKPKAGTQSKPKHIDADNEDDKSSTTA
SQPTKIKSERRSISQGGEKDKASSSSPSSSQQSNRIKRSHSPSQQNSRSS
SVEAKPARRSGRSPIRPSRFKNFVVGETRSGKSRGPKPKVKRVSPVPAKD
FKVEHMDGGRFNALQRLDSMLDTPKPREVKIL*

GH18902.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG4951-PA 320 CG4951-PA 1..320 13..332 1645 100 Plus
CG4951-PB 446 CG4951-PB 1..320 13..332 1645 100 Plus

GH18902.pep Sequence

Translation from 37 to 999

> GH18902.pep
MSFSAIGDCQLISQLYQYKKHRVICSVKVLPTPVTHFERESKNDFHWMTA
DRWSRIECGLWRLFENLKQWQDAYQLDTELIIDHIIVRVQATNKSHPATV
ALLAGTESSSKDLCLDLQLQYITQEDTTIVDVIPAKRELATEAETNGTRP
TSRKIRVANSGSKPKAGTQSKPKHIDADNEDDKSSTTASQPTKIKSERRS
ISQGGEKDKASSSSPSSSQQSNRIKRSHSPSQQNSRSSSVEAKPARRSGR
SPIRPSRFKNFVVGETRSGKSRGPKPKVKRVSPVPAKDFKVEHMDGGRFN
ALQRLDSMLDTPKPREVKIL*

GH18902.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16135-PA 448 GF16135-PA 1..322 1..320 923 59 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12080-PA 439 GG12080-PA 1..313 1..320 1279 79.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19163-PA 467 GH19163-PA 1..340 1..320 435 36.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG4951-PB 446 CG4951-PB 1..320 1..320 1645 100 Plus
CG4951-PA 320 CG4951-PA 1..320 1..320 1645 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23268-PA 469 GI23268-PA 1..342 1..320 490 36.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23879-PA 247 GL23879-PA 1..239 1..264 379 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18549-PB 335 GA18549-PB 1..286 1..264 367 37.4 Plus
Dpse\GA18549-PA 460 GA18549-PA 1..286 1..264 366 37.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16306-PA 319 GM16306-PA 1..319 1..320 1529 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18044-PA 319 GD18044-PA 1..319 1..320 1520 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10769-PA 479 GJ10769-PA 1..351 1..320 514 36.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22531-PA 269 GK22531-PA 1..263 48..320 324 38.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10525-PA 319 GE10525-PA 1..319 1..320 1382 83.4 Plus