Clone GH18955 Report

Search the DGRC for GH18955

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:189
Well:55
Vector:pOT2
Associated Gene/TranscriptCG1468-RA
Protein status:GH18955.pep: gold
Preliminary Size:895
Sequenced Size:733

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1468 2001-01-01 Release 2 assignment
CG1468 2003-01-01 Sim4 clustering to Release 3
CG1468 2003-02-22 Blastp of sequenced clone
CG1468 2008-04-29 Release 5.5 accounting
CG1468 2008-08-15 Release 5.9 accounting
CG1468 2008-12-18 5.12 accounting

Clone Sequence Records

GH18955.complete Sequence

733 bp (733 high quality bases) assembled on 2003-02-22

GenBank Submission: AY069161

> GH18955.complete
CGATGAGCAGATCCCTGTTTCTAATTCTTTTATTGGGAATCTCCTGCCTG
GAGATTTTCCAGGCTCGCTCTCTTCTGGAGGGGAGAAAACAAAGATTTGT
GCGCAGACGCATATCACCCGACGATCCTGATCTCGAGATCATCGAGGTCA
AGGACGTCTACTACCGAAAGCGGCCCAAGAAGTTGGTTGTCCAGCTCGAT
GATGACGAATTAAACTGGAAAATTCGCTGTGACTTCGATCCAAGCAATCC
GGAGTGTGGAGATGTAGTGAAGAAACCCGTGGCTCCTATCAGGCCAACCA
CAACCACCAACCCCACCACAACCACTAGCAGAACCACCACCACCACCACA
ACTGAACCCACAACAGAACCCACAACTGAACCCACAACTGAACCCACAAC
TGAACCCACAACTGAACCCACAACTGAACCTACAACTGAACCGACAGAAG
CACCAGATACAGATGATAATATCGAATTGTTCGGCGACAATGAAGAGGAC
TCTGAGGATCAGGAGGATCTAGATGATCAAGGAGATCAGGAGTATCAGGA
GGTTGACCCCTATGGCACTTACGATAGCCAAATCCACTCAATTGGGGCTA
ATGATGACGGCAACTGGAATTAGACCCAAATGAAAAGCAGCAAATGATCG
ATTCGATCTGTTGACTCAATTGAACATCAATAAAATGGCAATAGCGGAAC
TGCGCTACATAATGTAAAAAAAAAAAAAAAAAA

GH18955.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG1468-RA 925 CG1468-RA 111..827 1..717 3585 100 Plus
CG1468.a 1149 CG1468.a 435..1149 1..715 3575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9770526..9770985 256..715 2255 99.3 Plus
chrX 22417052 chrX 9770148..9770404 1..257 1240 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9878820..9879281 256..717 2310 100 Plus
X 23542271 X 9878442..9878698 1..257 1285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9886918..9887379 256..717 2310 100 Plus
X 23527363 X 9886540..9886796 1..257 1285 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:43:09 has no hits.

GH18955.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:43:47 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9770148..9770402 1..255 98 -> Plus
chrX 9770526..9770985 256..715 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:38 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 1..621 3..623 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:49:03 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 1..621 3..623 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:05 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 1..621 3..623 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:26 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 1..621 3..623 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:18:29 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 1..621 3..623 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:37 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 21..735 1..715 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:49:03 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 21..735 1..715 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:05 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 21..735 1..715 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:26 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 21..735 1..715 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:18:29 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
CG1468-RA 21..735 1..715 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:47 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
X 9878442..9878696 1..255 100 -> Plus
X 9878820..9879279 256..715 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:47 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
X 9878442..9878696 1..255 100 -> Plus
X 9878820..9879279 256..715 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:43:47 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
X 9878442..9878696 1..255 100 -> Plus
X 9878820..9879279 256..715 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:05 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9772475..9772729 1..255 100 -> Plus
arm_X 9772853..9773312 256..715 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:50 Download gff for GH18955.complete
Subject Subject Range Query Range Percent Splice Strand
X 9886540..9886794 1..255 100 -> Plus
X 9886918..9887377 256..715 100   Plus

GH18955.pep Sequence

Translation from 2 to 622

> GH18955.pep
MSRSLFLILLLGISCLEIFQARSLLEGRKQRFVRRRISPDDPDLEIIEVK
DVYYRKRPKKLVVQLDDDELNWKIRCDFDPSNPECGDVVKKPVAPIRPTT
TTNPTTTTSRTTTTTTTEPTTEPTTEPTTEPTTEPTTEPTTEPTTEPTEA
PDTDDNIELFGDNEEDSEDQEDLDDQGDQEYQEVDPYGTYDSQIHSIGAN
DDGNWN*

GH18955.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19137-PA 258 GF19137-PA 1..92 1..96 252 57.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18328-PA 253 GG18328-PA 1..88 1..88 326 65.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG1468-PA 206 CG1468-PA 1..206 1..206 1102 100 Plus
Mur11Da-PD 626 CG32644-PD 299..390 79..159 158 51.1 Plus
CG43710-PA 340 CG43710-PA 107..179 80..151 157 47.9 Plus
CG14420-PA 293 CG14420-PA 62..148 99..180 154 42.5 Plus
CG43710-PA 340 CG43710-PA 116..193 81..158 151 43.6 Plus
CG43710-PA 340 CG43710-PA 101..175 78..151 150 45.3 Plus
CG6912-PA 433 CG6912-PA 90..156 92..151 150 58.2 Plus
Mur82C-PB 578 CG12586-PB 227..284 97..153 149 56.9 Plus
CG34220-PA 726 CG34220-PA 263..338 80..153 149 48.7 Plus
CG34220-PA 726 CG34220-PA 513..581 80..148 148 49.3 Plus
CG14420-PA 293 CG14420-PA 49..142 89..185 147 37.1 Plus
CG14419-PA 195 CG14419-PA 16..91 85..153 147 42.1 Plus
Muc96D-PA 881 CG31439-PA 487..541 99..153 147 58.2 Plus
CG14419-PA 195 CG14419-PA 49..147 99..180 144 35.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15988-PA 203 GI15988-PA 35..102 28..92 142 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16378-PA 273 GL16378-PA 1..105 1..101 187 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22358-PA 266 GA22358-PA 1..93 1..88 187 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11392-PA 206 GM11392-PA 1..206 1..206 472 64.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14578-PA 168 GD14578-PA 1..96 1..96 394 77.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18717-PA 211 GJ18717-PA 40..105 30..92 157 47 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18848-PA 213 GK18848-PA 5..98 9..88 153 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17814-PA 268 GE17814-PA 12..94 12..94 340 73.5 Plus

GH18955.hyp Sequence

Translation from 2 to 622

> GH18955.hyp
MSRSLFLILLLGISCLEIFQARSLLEGRKQRFVRRRISPDDPDLEIIEVK
DVYYRKRPKKLVVQLDDDELNWKIRCDFDPSNPECGDVVKKPVAPIRPTT
TTNPTTTTSRTTTTTTTEPTTEPTTEPTTEPTTEPTTEPTTEPTTEPTEA
PDTDDNIELFGDNEEDSEDQEDLDDQGDQEYQEVDPYGTYDSQIHSIGAN
DDGNWN*

GH18955.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG1468-PA 206 CG1468-PA 1..206 1..206 1102 100 Plus
Mur11Da-PD 626 CG32644-PD 299..390 79..159 158 51.1 Plus
CG43710-PA 340 CG43710-PA 107..179 80..151 157 47.9 Plus
CG14420-PA 293 CG14420-PA 62..148 99..180 154 42.5 Plus
CG43710-PA 340 CG43710-PA 116..193 81..158 151 43.6 Plus
CG43710-PA 340 CG43710-PA 101..175 78..151 150 45.3 Plus
CG14420-PA 293 CG14420-PA 49..142 89..185 147 37.1 Plus
CG14419-PA 195 CG14419-PA 16..91 85..153 147 42.1 Plus