Clone GH19142 Report

Search the DGRC for GH19142

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:191
Well:42
Vector:pOT2
Associated Gene/TranscriptCG17549-RA
Protein status:GH19142.pep: gold
Preliminary Size:1179
Sequenced Size:1047

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17549 2001-01-01 Release 2 assignment
CG17549 2003-01-01 Sim4 clustering to Release 3
CG17549 2003-02-27 Blastp of sequenced clone
CG17549 2008-04-29 Release 5.5 accounting
CG17549 2008-08-15 Release 5.9 accounting
CG17549 2008-12-18 5.12 accounting

Clone Sequence Records

GH19142.complete Sequence

1047 bp (1047 high quality bases) assembled on 2003-02-27

GenBank Submission: AY060741

> GH19142.complete
GGAAGTCTCCAAAGTTCAATCGCAAATGCCCAGATAAAAATATGTGGAAG
GTTCTACTTATTTGTGTGGTGATGAGTGCTCTGAATGAAGAGTCATCGGG
AGCAAAAACGGCTCCGACCCGCAGACGACGAGCATATGCCGGCGGTTACG
CCGGAGGGTATGCCAGCAGTGGAGGAGGAGCCGGTGGCTATACGGGAAGC
TATAACAGTGGCGGTGGACACAGCAGCTATGTGGGTACCGGTGGTGGTGG
CGGTAGTGGCTATTACGATTACGATGACTATGGCGGCACTTCACCCAACT
TTGGCATCATCGATCCGTATCTATTCCACCAGCAGCTGACGAATCATATT
TTGGCCCAGAACTTCGCCAACCAACAAGCTATAACTGGTCTGGCCACGGC
TGGCAATGCTTATGCATCCGCGGATGCATCTCTTGTCAACGACAACGATA
TTCGCATCCAGCAACAGATCGCCGCTCAACAGGCCTACCACGACAATCTA
GTGCGCCAGAATCGGTACAGAGGAGGCACCAGCTCTAGCTTCAGTTCCAG
CTCTGGATCCGGGTCTGGATCTGGATCGGGATCCTACAACTCACATCGCT
ATGCACCCAGCTATGCATCAGCTTCCGGATCTATCGGTTCCAATGGCTAT
CGCCAGACGGCCTTCATTAGCCCATCCAATCCGGCCTCTCCCAACATTGT
GAATCGCTTTGGCGGCGGAAGCGGTGGTGGATCCTCGTTCTCCAGCTCCA
GCAGCTCCGGAGGAGGTGGTGGCAGCGGTGGTGGCTACAAGGGCGTCTCG
GTCTCGTCCTTCAGCCACAGCAACGGAGACGGAACCAGTCGACGTGGAGC
CCAGACCACGGTCAACGACAACGGAAAGATCACCTCGTATTCGGTGCACT
CCTAGAAAGATCGGCGGAGACCCTCCACTGGTGGCTAGGCTAACATTTAC
TCCGGTCTGACAAAGCAAACCGCTTCCATTGAATATGTATAAAATATAAA
AATAATATACGTGTATTTTATTGTCAAAAAAAAAAAAAAAAAAAAAA

GH19142.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG17549-RA 1247 CG17549-RA 149..1176 1..1028 5140 100 Plus
CG17549-RD 1275 CG17549-RD 248..1269 7..1028 5110 100 Plus
CG17549.a 1269 CG17549.a 251..1269 7..1025 5095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19385585..19385927 1025..683 1685 99.4 Minus
chr2L 23010047 chr2L 19386566..19386841 376..101 1380 100 Minus
chr2L 23010047 chr2L 19386072..19386304 684..452 1105 98.3 Minus
chr2L 23010047 chr2L 19387000..19387095 102..7 480 100 Minus
chr2L 23010047 chr2L 19386397..19386471 451..377 360 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:58:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19387047..19387392 1028..683 1730 100 Minus
2L 23513712 2L 19388040..19388315 376..101 1380 100 Minus
2L 23513712 2L 19387537..19387769 684..452 1165 100 Minus
2L 23513712 2L 19388474..19388569 102..7 480 100 Minus
2L 23513712 2L 19387862..19387936 451..377 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19387047..19387392 1028..683 1730 100 Minus
2L 23513712 2L 19388040..19388315 376..101 1380 100 Minus
2L 23513712 2L 19387537..19387769 684..452 1165 100 Minus
2L 23513712 2L 19388474..19388569 102..7 480 100 Minus
2L 23513712 2L 19387862..19387936 451..377 375 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:03:10 has no hits.

GH19142.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:04:11 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19386397..19386471 377..451 98 <- Minus
chr2L 19385585..19385926 684..1025 92 <- Minus
chr2L 19386073..19386304 452..683 98 <- Minus
chr2L 19386566..19386839 103..376 100 <- Minus
chr2L 19387000..19387097 1..102 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:48:51 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:46 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RD 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:42:11 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:39:09 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:08:36 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:48 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 30..1054 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:46 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 30..1054 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:42:11 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 30..1054 1..1025 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:39:10 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 30..1054 1..1025 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:08:36 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
CG17549-RA 30..1054 1..1025 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:11 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19387862..19387936 377..451 100 <- Minus
2L 19387050..19387391 684..1025 100 <- Minus
2L 19387538..19387769 452..683 100 <- Minus
2L 19388040..19388313 103..376 100 <- Minus
2L 19388474..19388571 1..102 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:11 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19387862..19387936 377..451 100 <- Minus
2L 19387050..19387391 684..1025 100 <- Minus
2L 19387538..19387769 452..683 100 <- Minus
2L 19388040..19388313 103..376 100 <- Minus
2L 19388474..19388571 1..102 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:11 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19387862..19387936 377..451 100 <- Minus
2L 19387050..19387391 684..1025 100 <- Minus
2L 19387538..19387769 452..683 100 <- Minus
2L 19388040..19388313 103..376 100 <- Minus
2L 19388474..19388571 1..102 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:42:11 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19387050..19387391 684..1025 100 <- Minus
arm_2L 19387538..19387769 452..683 100 <- Minus
arm_2L 19387862..19387936 377..451 100 <- Minus
arm_2L 19388040..19388313 103..376 100 <- Minus
arm_2L 19388474..19388571 1..102 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:29 Download gff for GH19142.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19387050..19387391 684..1025 100 <- Minus
2L 19387538..19387769 452..683 100 <- Minus
2L 19387862..19387936 377..451 100 <- Minus
2L 19388040..19388313 103..376 100 <- Minus
2L 19388474..19388571 1..102 96   Minus

GH19142.hyp Sequence

Translation from 4 to 904

> GH19142.hyp
APKFNRKCPDKNMWKVLLICVVMSALNEESSGAKTAPTRRRRAYAGGYAG
GYASSGGGAGGYTGSYNSGGGHSSYVGTGGGGGSGYYDYDDYGGTSPNFG
IIDPYLFHQQLTNHILAQNFANQQAITGLATAGNAYASADASLVNDNDIR
IQQQIAAQQAYHDNLVRQNRYRGGTSSSFSSSSGSGSGSGSGSYNSHRYA
PSYASASGSIGSNGYRQTAFISPSNPASPNIVNRFGGGSGGGSSFSSSSS
SGGGGGSGGGYKGVSVSSFSHSNGDGTSRRGAQTTVNDNGKITSYSVHS*

GH19142.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17549-PD 287 CG17549-PD 1..287 13..299 1501 100 Plus
CG17549-PA 287 CG17549-PA 1..287 13..299 1501 100 Plus
CG17549-PE 262 CG17549-PE 1..262 13..299 1339 90.9 Plus
CG17549-PC 262 CG17549-PC 1..262 13..299 1339 90.9 Plus
CG17549-PB 262 CG17549-PB 1..262 13..299 1339 90.9 Plus

GH19142.pep Sequence

Translation from 41 to 904

> GH19142.pep
MWKVLLICVVMSALNEESSGAKTAPTRRRRAYAGGYAGGYASSGGGAGGY
TGSYNSGGGHSSYVGTGGGGGSGYYDYDDYGGTSPNFGIIDPYLFHQQLT
NHILAQNFANQQAITGLATAGNAYASADASLVNDNDIRIQQQIAAQQAYH
DNLVRQNRYRGGTSSSFSSSSGSGSGSGSGSYNSHRYAPSYASASGSIGS
NGYRQTAFISPSNPASPNIVNRFGGGSGGGSSFSSSSSSGGGGGSGGGYK
GVSVSSFSHSNGDGTSRRGAQTTVNDNGKITSYSVHS*

GH19142.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15198-PA 287 GF15198-PA 1..287 1..287 744 79.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21637-PA 282 GG21637-PA 1..282 1..287 850 91.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12934-PA 213 GH12934-PA 1..213 11..287 590 57.6 Plus
Dgri\GH13471-PA 217 GH13471-PA 47..217 74..287 580 64.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG17549-PD 287 CG17549-PD 1..287 1..287 1501 100 Plus
CG17549-PA 287 CG17549-PA 1..287 1..287 1501 100 Plus
CG17549-PE 262 CG17549-PE 1..262 1..287 1339 90.9 Plus
CG17549-PC 262 CG17549-PC 1..262 1..287 1339 90.9 Plus
CG17549-PB 262 CG17549-PB 1..262 1..287 1339 90.9 Plus
CG9083-PB 317 CG9083-PB 63..313 34..266 164 30.2 Plus
sbb-PE 929 CG5580-PE 383..608 18..261 163 28.2 Plus
sbb-PC 929 CG5580-PC 383..608 18..261 163 28.2 Plus
sbb-PF 939 CG5580-PF 393..618 18..261 163 28.2 Plus
sbb-PH 2302 CG5580-PH 383..608 18..261 163 28.2 Plus
sbb-PD 2302 CG5580-PD 383..608 18..261 163 28.2 Plus
sbb-PG 2312 CG5580-PG 393..618 18..261 163 28.2 Plus
sbb-PJ 2330 CG5580-PJ 393..618 18..261 163 28.2 Plus
CG9083-PB 317 CG9083-PB 37..243 43..272 158 27.4 Plus
NAT1-PD 1488 CG3845-PD 145..379 18..284 154 28.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17223-PA 222 GI17223-PA 46..222 74..287 567 67.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21111-PA 264 GL21111-PA 86..264 85..287 655 78.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14551-PA 266 GA14551-PA 86..266 85..287 655 79.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17015-PA 274 GM17015-PA 1..274 1..287 1278 93 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21765-PA 277 GD21765-PA 1..277 1..287 793 89.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17980-PA 238 GJ17980-PA 58..238 86..287 537 72.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23840-PA 279 GK23840-PA 1..279 1..287 716 76.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12656-PA 285 GE12656-PA 1..285 1..287 826 90.6 Plus