BDGP Sequence Production Resources |
Search the DGRC for GH19182
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 191 |
Well: | 82 |
Vector: | pOT2 |
Associated Gene/Transcript | Zasp66-RF |
Protein status: | GH19182.pep: gold |
Preliminary Size: | 1940 |
Sequenced Size: | 1713 |
Gene | Date | Evidence |
---|---|---|
CG6416 | 2001-01-01 | Release 2 assignment |
CG6416 | 2001-09-19 | Blastp of sequenced clone |
CG6416 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6416 | 2008-04-29 | Release 5.5 accounting |
CG6416 | 2008-08-15 | Release 5.9 accounting |
CG6416 | 2008-12-18 | 5.12 accounting |
1713 bp (1713 high quality bases) assembled on 2001-09-19
GenBank Submission: AY058415
> GH19182.complete ATCGAACAAAACGCTTAACGGATTGCAATCGCGCGCCGCCTGCGGCTCGG CCAGAAAAGGCCAGAAAAAAAAATAAACAATAAAAAATAAATATATATTT TCGGGATAAACCATCGCTGGATCGGATGAGCGTCTGATCTTCCAGTCTAT CTTCAACATCAGGATGAGCCCCAAGCTGCATGAGTTTGCGGTGGTGCTAC TGCGCGATGGTCAGGCCACGCCCTGGGGCATTCGTTTGGTGGGCGGCAAC GATCTGGACACGCCGCTAATTATCACCAGGGTGCAAGTGGGCAGCCCAGC GCATGGCGAACTTCTAAGAGGCGACATCATCTCGAAGATCGGCGAGTACG ACGCACGCGACCTGAGTCATGCGGATGCACAGCAGCTGTTCCGCGGCGCT GGCAACGAGATCCGCCTGGTGGTGCACAGGGACAACAAAATCGCCTACAC GCAGGGTGCAACTCAGGAGGCAGGTCCTGGATCTCGGAGCAACTCCACTT TGCCGCCGGTCACTCCGGATCTGATGCCCCACCGCGGTCCGTCGCCCTTT TTGCCCGGACCCAGCCACTTTGAGAGGGCCCTCCAGTTGCCGGTGGACAC GTTGCCGCAGACCGTGTTTCCCCAGCTGAACTCATCCGGTGGCTATGAGG TGCCATCGACTGTGTTCTCACCCAAGCCAACCAGGGACCATCAACAAGAC GTCGATGAGGAGCAGGCGGCCATTGTGAATCAGCCCTACCGTACAACTCC GCTGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGT CCTACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACAC GACTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCA CAAGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAAT TCAACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATC AGATCCACAGTTCCCTTCGCCACAAGCGAAAGCAATCGCTTGAAGGACAG TCCTTTGCATCGTCCTTTGCCAACAAAACTTAACGGCTATAAGAAAACTG TCCAGTACGATCCCAGGAACAGCGAAACCTACAGAGCCATTCAAGAAGAG GGCGGCTACAGCAACTATGGCCAATCCTCGCCACAGGAAGTGACCATTCC TGTGCAGACTAAGGTCTATCAGCCCAATAGATTGGTTCCAGGAAAGAAAC CAGTATCAGCGCCAGTATCCCGGCCGCCGTACAATGTGGTAAACACCCAC GATGAGAACATACGCCAGAGCGGCTCCTTCAATCGTCTCATGTACAGCGT GATTGGTGCCACCGAGTACTAGAAAGTGCAGCTGCAACACCAGCGACAGC AGCAACATCAACATCAACGCAACATCGGCAACATCTGCTGCACTTGTTTT ATCTCCTAACATATTTAGCGGATTTTTATGAAATTCTGTTTAACTTACTC AATAAATTATATGAAGAACGACAAGAAATTGTGAACCACTAACAAGCTTG ATGATATAATGGATTGGTAATCAATTGGCATCGAAATAAATTTACGATAT AAACACCACTTAACGCCGCCTCAACCTAATTACTGTCTGCATATGCAATA GAAAACGTATATAAATTAATTAAATAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-RF | 1898 | Zasp66-RF | 23..1707 | 1..1685 | 8425 | 100 | Plus |
Zasp66-RM | 1691 | Zasp66-RM | 23..1108 | 1..1086 | 5430 | 100 | Plus |
Zasp66-RK | 1826 | Zasp66-RK | 23..1038 | 1..1016 | 5080 | 100 | Plus |
Zasp66-RK | 1826 | Zasp66-RK | 1037..1635 | 1087..1685 | 2995 | 100 | Plus |
Zasp66-RM | 1691 | Zasp66-RM | 1108..1547 | 1246..1685 | 2200 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8630302..8630691 | 1286..1675 | 1935 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 8619449..8619755 | 427..733 | 1535 | 100 | Plus |
chr3L | 24539361 | chr3L | 8618256..8618537 | 1..282 | 1410 | 100 | Plus |
chr3L | 24539361 | chr3L | 8626611..8626816 | 731..936 | 1015 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 8629473..8629633 | 1086..1246 | 805 | 100 | Plus |
chr3L | 24539361 | chr3L | 8618985..8619135 | 280..430 | 755 | 100 | Plus |
chr3L | 24539361 | chr3L | 8627036..8627112 | 938..1014 | 370 | 98.7 | Plus |
chr3L | 24539361 | chr3L | 8627718..8627800 | 1015..1097 | 370 | 96.4 | Plus |
chr3L | 24539361 | chr3L | 8630190..8630233 | 1245..1288 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8638267..8638666 | 1286..1685 | 2000 | 100 | Plus |
3L | 28110227 | 3L | 8627424..8627730 | 427..733 | 1535 | 100 | Plus |
3L | 28110227 | 3L | 8626231..8626512 | 1..282 | 1410 | 100 | Plus |
3L | 28110227 | 3L | 8634580..8634785 | 731..936 | 1030 | 100 | Plus |
3L | 28110227 | 3L | 8637438..8637598 | 1086..1246 | 805 | 100 | Plus |
3L | 28110227 | 3L | 8626960..8627110 | 280..430 | 755 | 100 | Plus |
3L | 28110227 | 3L | 8635002..8635081 | 935..1014 | 400 | 100 | Plus |
3L | 28110227 | 3L | 8635681..8635763 | 1015..1097 | 370 | 96.4 | Plus |
3L | 28110227 | 3L | 8638155..8638198 | 1245..1288 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8631367..8631766 | 1286..1685 | 2000 | 100 | Plus |
3L | 28103327 | 3L | 8620524..8620830 | 427..733 | 1535 | 100 | Plus |
3L | 28103327 | 3L | 8619331..8619612 | 1..282 | 1410 | 100 | Plus |
3L | 28103327 | 3L | 8627680..8627885 | 731..936 | 1030 | 100 | Plus |
3L | 28103327 | 3L | 8630538..8630698 | 1086..1246 | 805 | 100 | Plus |
3L | 28103327 | 3L | 8620060..8620210 | 280..430 | 755 | 100 | Plus |
3L | 28103327 | 3L | 8628102..8628181 | 935..1014 | 400 | 100 | Plus |
3L | 28103327 | 3L | 8628781..8628863 | 1015..1097 | 370 | 96.3 | Plus |
3L | 28103327 | 3L | 8631255..8631298 | 1245..1288 | 220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6828..6890 | 1374..1435 | 186 | 79.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2295..2371 | 1366..1442 | 177 | 73.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6721..6804 | 1363..1442 | 167 | 70.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1512..1587 | 1373..1441 | 166 | 73.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6722..6783 | 1379..1442 | 162 | 76.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6798..6879 | 1365..1442 | 157 | 69.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2761..2840 | 1365..1443 | 155 | 71.1 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1083..1154 | 1365..1435 | 150 | 69.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6753..6825 | 1374..1442 | 148 | 71.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1092..1273 | 1365..1535 | 148 | 59.1 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 3280..3345 | 1374..1438 | 147 | 71.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2340..2404 | 1379..1442 | 142 | 70.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6774..6839 | 1374..1435 | 140 | 72.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2789..2854 | 1378..1442 | 138 | 69.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6794..6855 | 1379..1442 | 135 | 70.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2383..2461 | 1365..1442 | 133 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2632..2665 | 1380..1413 | 125 | 85.3 | Plus |
Doc3-element | 4740 | Doc3-element DOC3 4740bp | 528..577 | 1370..1422 | 123 | 73.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2418..2484 | 1360..1432 | 117 | 67.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1541..1581 | 1378..1418 | 115 | 75.6 | Plus |
gypsy10 | 6006 | gypsy10 GYPSY10 6006bp | 65..127 | 975..1036 | 114 | 68.8 | Plus |
gypsy10 | 6006 | gypsy10 GYPSY10 6006bp | 5707..5769 | 975..1036 | 114 | 68.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2602..2665 | 1365..1424 | 112 | 68.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8629474..8629633 | 1087..1246 | 100 | -> | Plus |
chr3L | 8630192..8630230 | 1247..1285 | 100 | -> | Plus |
chr3L | 8630302..8630393 | 1286..1377 | 100 | == | Plus |
chr3L | 8618986..8619134 | 281..429 | 100 | -> | Plus |
chr3L | 8619452..8619755 | 430..733 | 100 | -> | Plus |
chr3L | 8626614..8626814 | 734..934 | 99 | -> | Plus |
chr3L | 8627033..8627112 | 935..1014 | 97 | -> | Plus |
chr3L | 8627718..8627789 | 1015..1086 | 100 | -> | Plus |
chr3L | 8630460..8630673 | 1444..1657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 1..1209 | 164..1372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RF | 1..1209 | 164..1372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RF | 1..1209 | 164..1372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 1..1209 | 164..1372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RF | 1..1209 | 164..1372 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 23..1697 | 1..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RF | 23..1697 | 1..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RF | 23..1697 | 1..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6416-RF | 23..1697 | 1..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Zasp66-RF | 23..1697 | 1..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8634583..8634783 | 734..934 | 100 | -> | Plus |
3L | 8635002..8635081 | 935..1014 | 100 | -> | Plus |
3L | 8635681..8635752 | 1015..1086 | 100 | -> | Plus |
3L | 8637439..8637598 | 1087..1246 | 100 | -> | Plus |
3L | 8638157..8638195 | 1247..1285 | 100 | -> | Plus |
3L | 8627427..8627730 | 430..733 | 100 | -> | Plus |
3L | 8626231..8626510 | 1..280 | 100 | -> | Plus |
3L | 8626961..8627109 | 281..429 | 100 | -> | Plus |
3L | 8638267..8638656 | 1286..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8634583..8634783 | 734..934 | 100 | -> | Plus |
3L | 8635002..8635081 | 935..1014 | 100 | -> | Plus |
3L | 8635681..8635752 | 1015..1086 | 100 | -> | Plus |
3L | 8637439..8637598 | 1087..1246 | 100 | -> | Plus |
3L | 8638157..8638195 | 1247..1285 | 100 | -> | Plus |
3L | 8627427..8627730 | 430..733 | 100 | -> | Plus |
3L | 8626231..8626510 | 1..280 | 100 | -> | Plus |
3L | 8626961..8627109 | 281..429 | 100 | -> | Plus |
3L | 8638267..8638656 | 1286..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8634583..8634783 | 734..934 | 100 | -> | Plus |
3L | 8635002..8635081 | 935..1014 | 100 | -> | Plus |
3L | 8635681..8635752 | 1015..1086 | 100 | -> | Plus |
3L | 8637439..8637598 | 1087..1246 | 100 | -> | Plus |
3L | 8638157..8638195 | 1247..1285 | 100 | -> | Plus |
3L | 8627427..8627730 | 430..733 | 100 | -> | Plus |
3L | 8626231..8626510 | 1..280 | 100 | -> | Plus |
3L | 8626961..8627109 | 281..429 | 100 | -> | Plus |
3L | 8638267..8638656 | 1286..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8620061..8620209 | 281..429 | 100 | -> | Plus |
arm_3L | 8619331..8619610 | 1..280 | 100 | -> | Plus |
arm_3L | 8620527..8620830 | 430..733 | 100 | -> | Plus |
arm_3L | 8627683..8627883 | 734..934 | 100 | -> | Plus |
arm_3L | 8628102..8628181 | 935..1014 | 100 | -> | Plus |
arm_3L | 8628781..8628852 | 1015..1086 | 100 | -> | Plus |
arm_3L | 8630539..8630698 | 1087..1246 | 100 | -> | Plus |
arm_3L | 8631257..8631295 | 1247..1285 | 100 | -> | Plus |
arm_3L | 8631367..8631756 | 1286..1675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8627683..8627883 | 734..934 | 100 | -> | Plus |
3L | 8628102..8628181 | 935..1014 | 100 | -> | Plus |
3L | 8628781..8628852 | 1015..1086 | 100 | -> | Plus |
3L | 8630539..8630698 | 1087..1246 | 100 | -> | Plus |
3L | 8631257..8631295 | 1247..1285 | 100 | -> | Plus |
3L | 8620527..8620830 | 430..733 | 100 | -> | Plus |
3L | 8619331..8619610 | 1..280 | 100 | -> | Plus |
3L | 8620061..8620209 | 281..429 | 100 | -> | Plus |
3L | 8631367..8631756 | 1286..1675 | 100 | Plus |
Translation from 163 to 1371
> GH19182.hyp MSPKLHEFAVVLLRDGQATPWGIRLVGGNDLDTPLIITRVQVGSPAHGEL LRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGAT QEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQT VFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLP GAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVG SEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHR PLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTK VYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGAT EY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PF | 402 | CG6416-PF | 1..402 | 1..402 | 2124 | 100 | Plus |
Zasp66-PK | 378 | CG6416-PK | 1..378 | 1..402 | 1963 | 94 | Plus |
Zasp66-PE | 430 | CG6416-PE | 68..430 | 40..402 | 1920 | 100 | Plus |
Zasp66-PN | 406 | CG6416-PN | 68..406 | 40..402 | 1759 | 93.4 | Plus |
Zasp66-PM | 322 | CG6416-PM | 1..320 | 1..320 | 1635 | 97.2 | Plus |
Translation from 163 to 1371
> GH19182.pep MSPKLHEFAVVLLRDGQATPWGIRLVGGNDLDTPLIITRVQVGSPAHGEL LRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGAT QEAGPGSRSNSTLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQT VFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPLVLP GAKVKKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVG SEADTGRVFHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHR PLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTK VYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIGAT EY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24342-PA | 430 | GF24342-PA | 1..430 | 1..402 | 1991 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14334-PA | 429 | GG14334-PA | 1..429 | 1..402 | 2045 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22527-PA | 193 | GH22527-PA | 1..190 | 1..190 | 829 | 83.3 | Plus |
Dgri\GH15318-PA | 149 | GH15318-PA | 5..149 | 258..402 | 698 | 91 | Plus |
Dgri\GH22528-PA | 181 | GH22528-PA | 17..122 | 177..285 | 493 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Zasp66-PF | 402 | CG6416-PF | 1..402 | 1..402 | 2124 | 100 | Plus |
Zasp66-PK | 378 | CG6416-PK | 1..378 | 1..402 | 1963 | 94 | Plus |
Zasp66-PE | 430 | CG6416-PE | 68..430 | 40..402 | 1920 | 100 | Plus |
Zasp66-PN | 406 | CG6416-PN | 68..406 | 40..402 | 1759 | 93.4 | Plus |
Zasp66-PM | 322 | CG6416-PM | 1..320 | 1..320 | 1635 | 97.2 | Plus |
Zasp66-PB | 298 | CG6416-PB | 1..284 | 1..284 | 1501 | 100 | Plus |
Zasp66-PO | 326 | CG6416-PO | 68..312 | 40..284 | 1297 | 100 | Plus |
Zasp66-PA | 239 | CG6416-PA | 17..239 | 177..402 | 1136 | 96 | Plus |
Zasp66-PJ | 239 | CG6416-PJ | 17..239 | 177..402 | 1136 | 96 | Plus |
Zasp66-PI | 215 | CG6416-PI | 17..215 | 177..402 | 975 | 85.4 | Plus |
Zasp66-PH | 135 | CG6416-PH | 17..121 | 177..284 | 513 | 91.7 | Plus |
Zasp66-PG | 165 | CG6416-PG | 17..121 | 177..284 | 513 | 91.7 | Plus |
Zasp67-PD | 604 | CG14168-PD | 14..163 | 20..149 | 158 | 32.7 | Plus |
Zasp67-PH | 682 | CG14168-PH | 14..163 | 20..149 | 158 | 32.7 | Plus |
Zasp67-PE | 725 | CG14168-PE | 14..163 | 20..149 | 158 | 32.7 | Plus |
Zasp67-PG | 730 | CG14168-PG | 14..163 | 20..149 | 158 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12917-PA | 429 | GI12917-PA | 1..429 | 1..402 | 1875 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10326-PA | 417 | GL10326-PA | 77..373 | 40..308 | 1279 | 82.8 | Plus |
Dper\GL10327-PA | 113 | GL10327-PA | 29..113 | 319..402 | 408 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19576-PA | 240 | GA19576-PA | 17..240 | 177..402 | 1073 | 91.2 | Plus |
Dpse\GA28193-PA | 202 | GA28193-PA | 1..196 | 1..195 | 912 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25076-PA | 429 | GM25076-PA | 1..429 | 1..402 | 2073 | 93 | Plus |
Dsec\GM24841-PA | 622 | GM24841-PA | 13..141 | 19..133 | 154 | 34.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14114-PA | 231 | GD14114-PA | 1..200 | 1..200 | 1000 | 95.5 | Plus |
Dsim\GD14114-PA | 231 | GD14114-PA | 177..231 | 348..402 | 217 | 78.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13061-PA | 429 | GJ13061-PA | 1..429 | 1..402 | 1853 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16724-PA | 243 | GK16724-PA | 17..243 | 177..402 | 1058 | 88.7 | Plus |
Dwil\GK16723-PA | 207 | GK16723-PA | 1..197 | 1..192 | 884 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20762-PA | 429 | GE20762-PA | 1..429 | 1..402 | 2062 | 92.3 | Plus |