BDGP Sequence Production Resources |
Search the DGRC for GH19356
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 193 |
Well: | 56 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13631-RA |
Protein status: | GH19356.pep: gold |
Preliminary Size: | 898 |
Sequenced Size: | 710 |
Gene | Date | Evidence |
---|---|---|
CG13631 | 2001-01-01 | Release 2 assignment |
CG13631 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13631 | 2003-01-14 | Blastp of sequenced clone |
CG13631 | 2008-04-29 | Release 5.5 accounting |
CG13631 | 2008-08-15 | Release 5.9 accounting |
CG13631 | 2008-12-18 | 5.12 accounting |
710 bp (710 high quality bases) assembled on 2003-01-14
GenBank Submission: AY060742
> GH19356.complete CGGATCAACTGCTCCACACGCCACGCCACGCCGAAAATCGCTCAATAAAT ATATAAAAGCGGACTAGCCACCAATAACAAAAATATCCACATCACGTGCA ACATGTCGCATCAGTGCAGCTGCGGTCGCGACCTCAACAACAACTACGTC TCGTACACCAACGCCTACGCCAATGCGAATGCATCTCTGGACCGCGAGGC GGCCACCAGCGGCAAGTCCGGCGGTCCGCCCCGCGCCCAGCTGACGGCCA AGGTGATGTTCGGTACGGTGGGCGCCATCAAGGAGCTGCGCGACAAGGAG CAGCAGCAACAGCAGCAGCGGCAGGCGGCACGAGCGGGCGAGAGGCGCAA CTGAGAGGCTGCACGAGGAAGGGGGCGGGGCGGGACGGGGCGGGACGAAC GGTCGCAGGAGCGGTCGAGTGCTGTGCTGTGGGTTGTCGGCGGGGGATCT CTGGCTGATCGGAGGAAGGATAACACGGAGATATGGATTTGGATATGACA CAAAGAATTCGCGCCACTTCAAGGACCTAAAGAATTCAAGTTCGCGTAGT TCCCAAGATTCCAATGGGTAATCCAAATAGTTCGATTCGTATGACCCGAA TGGGTGATCCCCGGATCACGTTAGAGGCTTCAAAGTGTTGGCAGGGGACA GGGCAATCTGTGTAACGACATTCCTTCTCAACAATAACTATCAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13631-RA | 776 | CG13631-RA | 68..774 | 1..707 | 3535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 20592631..20593322 | 1..692 | 3460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 24769420..24770126 | 1..707 | 3535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 24510251..24510957 | 1..707 | 3535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6813..6865 | 281..334 | 131 | 78.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1068..1124 | 296..351 | 129 | 74.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6780..6835 | 281..337 | 128 | 75.9 | Plus |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 909..1030 | 216..335 | 128 | 60.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6759..6840 | 281..363 | 123 | 68.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6738..6826 | 281..370 | 121 | 66.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2353..2391 | 296..335 | 116 | 80 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2806..2879 | 299..372 | 116 | 68.4 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6727..6770 | 290..335 | 116 | 78.3 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2794..2841 | 281..328 | 114 | 70.8 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6723..6793 | 299..370 | 114 | 67.6 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6824..6884 | 276..335 | 112 | 73 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2335..2372 | 299..337 | 111 | 79.5 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6783..6839 | 296..351 | 111 | 70.7 | Plus |
Dyak\TART | 8444 | Dyak\TART TARTYAK 8444bp | 7956..7998 | 293..333 | 111 | 76.7 | Plus |
TART-C | 11124 | TART-C TARTC 11124bp | 9400..9442 | 293..333 | 111 | 76.7 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2629..2659 | 293..323 | 110 | 83.9 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2455..2483 | 296..324 | 109 | 86.2 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 1094..1138 | 280..324 | 108 | 71.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2353..2395 | 281..323 | 107 | 72.1 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 1558..1589 | 299..330 | 106 | 81.2 | Plus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6741..6813 | 296..369 | 106 | 65.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 20592631..20593322 | 1..692 | 92 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 1..252 | 103..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 1..252 | 103..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 1..252 | 103..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 1..252 | 103..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 68..759 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 67..758 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 70..761 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 68..759 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13631-RA | 70..761 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24769420..24770111 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24769420..24770111 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24769420..24770111 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 20595142..20595833 | 1..692 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24510251..24510942 | 1..692 | 100 | Plus |
Translation from 102 to 353
> GH19356.hyp MSHQCSCGRDLNNNYVSYTNAYANANASLDREAATSGKSGGPPRAQLTAK VMFGTVGAIKELRDKEQQQQQQRQAARAGERRN*
Translation from 102 to 353
> GH19356.pep MSHQCSCGRDLNNNYVSYTNAYANANASLDREAATSGKSGGPPRAQLTAK VMFGTVGAIKELRDKEQQQQQQRQAARAGERRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23046-PA | 84 | GF23046-PA | 1..84 | 1..83 | 327 | 79.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11316-PA | 83 | GG11316-PA | 1..83 | 1..83 | 434 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18448-PA | 86 | GH18448-PA | 1..86 | 1..83 | 299 | 72.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13631-PB | 83 | CG13631-PB | 1..83 | 1..83 | 428 | 100 | Plus |
CG13631-PA | 83 | CG13631-PA | 1..83 | 1..83 | 428 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24025-PA | 85 | GI24025-PA | 1..84 | 1..82 | 322 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13624-PA | 85 | GL13624-PA | 1..85 | 1..83 | 326 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12423-PA | 85 | GA12423-PA | 1..85 | 1..83 | 326 | 76.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26623-PA | 83 | GM26623-PA | 1..83 | 1..83 | 434 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21127-PA | 83 | GD21127-PA | 1..83 | 1..83 | 434 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23655-PA | 84 | GJ23655-PA | 1..83 | 1..82 | 314 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14036-PA | 80 | GK14036-PA | 1..80 | 1..83 | 313 | 77.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23512-PA | 83 | GE23512-PA | 1..83 | 1..83 | 434 | 100 | Plus |