Clone GH19356 Report

Search the DGRC for GH19356

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:193
Well:56
Vector:pOT2
Associated Gene/TranscriptCG13631-RA
Protein status:GH19356.pep: gold
Preliminary Size:898
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13631 2001-01-01 Release 2 assignment
CG13631 2003-01-01 Sim4 clustering to Release 3
CG13631 2003-01-14 Blastp of sequenced clone
CG13631 2008-04-29 Release 5.5 accounting
CG13631 2008-08-15 Release 5.9 accounting
CG13631 2008-12-18 5.12 accounting

Clone Sequence Records

GH19356.complete Sequence

710 bp (710 high quality bases) assembled on 2003-01-14

GenBank Submission: AY060742

> GH19356.complete
CGGATCAACTGCTCCACACGCCACGCCACGCCGAAAATCGCTCAATAAAT
ATATAAAAGCGGACTAGCCACCAATAACAAAAATATCCACATCACGTGCA
ACATGTCGCATCAGTGCAGCTGCGGTCGCGACCTCAACAACAACTACGTC
TCGTACACCAACGCCTACGCCAATGCGAATGCATCTCTGGACCGCGAGGC
GGCCACCAGCGGCAAGTCCGGCGGTCCGCCCCGCGCCCAGCTGACGGCCA
AGGTGATGTTCGGTACGGTGGGCGCCATCAAGGAGCTGCGCGACAAGGAG
CAGCAGCAACAGCAGCAGCGGCAGGCGGCACGAGCGGGCGAGAGGCGCAA
CTGAGAGGCTGCACGAGGAAGGGGGCGGGGCGGGACGGGGCGGGACGAAC
GGTCGCAGGAGCGGTCGAGTGCTGTGCTGTGGGTTGTCGGCGGGGGATCT
CTGGCTGATCGGAGGAAGGATAACACGGAGATATGGATTTGGATATGACA
CAAAGAATTCGCGCCACTTCAAGGACCTAAAGAATTCAAGTTCGCGTAGT
TCCCAAGATTCCAATGGGTAATCCAAATAGTTCGATTCGTATGACCCGAA
TGGGTGATCCCCGGATCACGTTAGAGGCTTCAAAGTGTTGGCAGGGGACA
GGGCAATCTGTGTAACGACATTCCTTCTCAACAATAACTATCAAAAAAAA
AAAAAAAAAA

GH19356.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RA 776 CG13631-RA 68..774 1..707 3535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20592631..20593322 1..692 3460 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24769420..24770126 1..707 3535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24510251..24510957 1..707 3535 100 Plus
Blast to na_te.dros performed 2019-03-15 15:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6865 281..334 131 78.2 Plus
roo 9092 roo DM_ROO 9092bp 1068..1124 296..351 129 74.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6780..6835 281..337 128 75.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 909..1030 216..335 128 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6759..6840 281..363 123 68.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6738..6826 281..370 121 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2391 296..335 116 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2806..2879 299..372 116 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6770 290..335 116 78.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2794..2841 281..328 114 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6793 299..370 114 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6824..6884 276..335 112 73 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2335..2372 299..337 111 79.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6783..6839 296..351 111 70.7 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7956..7998 293..333 111 76.7 Plus
TART-C 11124 TART-C TARTC 11124bp 9400..9442 293..333 111 76.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2629..2659 293..323 110 83.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2483 296..324 109 86.2 Plus
roo 9092 roo DM_ROO 9092bp 1094..1138 280..324 108 71.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2395 281..323 107 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1558..1589 299..330 106 81.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6813 296..369 106 65.8 Plus

GH19356.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:39:28 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20592631..20593322 1..692 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:49:07 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 1..252 103..354 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:30 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 1..252 103..354 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:34:51 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 1..252 103..354 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 21:31:34 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:37 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 1..252 103..354 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:59:57 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 68..759 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:30 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 67..758 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:34:51 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 70..761 1..692 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:35 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 68..759 1..692 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:37 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 70..761 1..692 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:28 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24769420..24770111 1..692 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:28 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24769420..24770111 1..692 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:28 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24769420..24770111 1..692 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:34:51 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20595142..20595833 1..692 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:10:44 Download gff for GH19356.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24510251..24510942 1..692 100   Plus

GH19356.hyp Sequence

Translation from 102 to 353

> GH19356.hyp
MSHQCSCGRDLNNNYVSYTNAYANANASLDREAATSGKSGGPPRAQLTAK
VMFGTVGAIKELRDKEQQQQQQRQAARAGERRN*

GH19356.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PB 83 CG13631-PB 1..83 1..83 428 100 Plus
CG13631-PA 83 CG13631-PA 1..83 1..83 428 100 Plus

GH19356.pep Sequence

Translation from 102 to 353

> GH19356.pep
MSHQCSCGRDLNNNYVSYTNAYANANASLDREAATSGKSGGPPRAQLTAK
VMFGTVGAIKELRDKEQQQQQQRQAARAGERRN*

GH19356.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23046-PA 84 GF23046-PA 1..84 1..83 327 79.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11316-PA 83 GG11316-PA 1..83 1..83 434 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18448-PA 86 GH18448-PA 1..86 1..83 299 72.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PB 83 CG13631-PB 1..83 1..83 428 100 Plus
CG13631-PA 83 CG13631-PA 1..83 1..83 428 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24025-PA 85 GI24025-PA 1..84 1..82 322 76.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13624-PA 85 GL13624-PA 1..85 1..83 326 76.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12423-PA 85 GA12423-PA 1..85 1..83 326 76.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26623-PA 83 GM26623-PA 1..83 1..83 434 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21127-PA 83 GD21127-PA 1..83 1..83 434 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23655-PA 84 GJ23655-PA 1..83 1..82 314 76.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14036-PA 80 GK14036-PA 1..80 1..83 313 77.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23512-PA 83 GE23512-PA 1..83 1..83 434 100 Plus