Clone GH19557 Report

Search the DGRC for GH19557

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:195
Well:57
Vector:pOT2
Associated Gene/TranscriptCG42371-RA
Protein status:GH19557.pep: gold
Preliminary Size:869
Sequenced Size:645

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15386 2002-01-01 Sim4 clustering to Release 2
CG15386 2003-01-01 Sim4 clustering to Release 3
CG15386 2008-04-29 Stopped prior to 5.5
CG15386-RA 2009-01-21 est gleaning

Clone Sequence Records

GH19557.complete Sequence

645 bp assembled on 2010-01-13

GenBank Submission: BT120123.1

> GH19557.complete
TTTAATATTTACAACTCCCACTTAAAATGCTGCGCAAAACACCAAAACCT
GCAATTTGGAAATTCATCAAAGGAAGTGCCAAAACACTGTTTGTCCTCGA
GGCAGTCTGCTTCGCAGCCAGCTACGGCGTTTATTATCGCATGAACACGA
ATCGAGAGTTTCGTCAGCATATTCACGAGAACTATCCCTTCGTTTTGGAC
TATTACTACAAAATTGGTGAAATCGTCGGAGACAGCACAGTGCGACAGGC
GGATGCGAGTTATTGGAGTGCTTTGAAGAAAAGCGACTAGAGGAGACCGC
TTCCAAAATGCTTAGTAATCCCTACTTTAAGTCCGTTTTGTGGCTGATTG
GCTTCGGAGGAATGGGGTACGGCCTAATGGTGTTAACCGAGCCGAACGTC
GACAAGTTAGAGCGCATCAAAGCCTCCGTTTCAAGTACCAAACTGAGTGC
GGATGAGCAGCGAAAGGCTCTGTTTATGAAGAAGCTCCAGGAGGCGTCCA
CCACCAGTGCCCCAATCTACAGGTCATCGTCCGAGAAATAGGATAGTTAG
GAAGCTTAATCGTCATCAATTTATCAATTTGTTATACTTTTTAAATACAA
ATGTTAAGCATTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH19557.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15386-RA 676 CG15386-RA 64..676 1..613 3065 100 Plus
CG42371-RA 676 CG42371-RA 64..676 1..613 3065 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2216232..2216690 613..155 2205 98.7 Minus
chr2L 23010047 chr2L 2216742..2216897 156..1 780 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2216501..2216961 615..155 2305 100 Minus
2L 23513712 2L 2217013..2217168 156..1 780 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2216501..2216961 615..155 2305 100 Minus
2L 23513712 2L 2217013..2217168 156..1 780 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:20:20 has no hits.

GH19557.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:21:15 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2216232..2216688 157..613 98 <- Minus
chr2L 2216742..2216897 1..156 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-13 17:25:03 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 27..290 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:30 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 27..290 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:27 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 27..290 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:42 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 27..290 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-13 17:25:01 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 64..676 1..613 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:29 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 64..676 1..613 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:27 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 79..691 1..613 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:42 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 79..691 1..613 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:15 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 157..613 100 <- Minus
2L 2217013..2217168 1..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:15 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 157..613 100 <- Minus
2L 2217013..2217168 1..156 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:15 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 157..613 100 <- Minus
2L 2217013..2217168 1..156 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:27 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2216503..2216959 157..613 100 <- Minus
arm_2L 2217013..2217168 1..156 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:40 Download gff for GH19557.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 157..613 100 <- Minus
2L 2217013..2217168 1..156 100   Minus

GH19557.hyp Sequence

Translation from 26 to 289

> GH19557.hyp
MLRKTPKPAIWKFIKGSAKTLFVLEAVCFAASYGVYYRMNTNREFRQHIH
ENYPFVLDYYYKIGEIVGDSTVRQADASYWSALKKSD*

GH19557.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42371-PA 87 CG42371-PA 1..87 1..87 465 100 Plus

GH19557.pep Sequence

Translation from 26 to 289

> GH19557.pep
MLRKTPKPAIWKFIKGSAKTLFVLEAVCFAASYGVYYRMNTNREFRQHIH
ENYPFVLDYYYKIGEIVGDSTVRQADASYWSALKKSD*

GH19557.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15297-PA 87 GF15297-PA 1..87 1..87 430 90.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11467-PA 91 GH11467-PA 1..82 1..82 360 75.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42371-PA 87 CG42371-PA 1..87 1..87 465 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16898-PA 90 GI16898-PA 1..82 1..82 344 73.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19413-PA 90 GL19413-PA 1..90 1..87 413 85.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25952-PA 90 GA25952-PA 1..90 1..87 413 85.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18253-PA 87 GM18253-PA 1..87 1..87 458 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22862-PA 87 GD22862-PA 1..87 1..87 451 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17208-PA 91 GJ17208-PA 1..82 1..82 362 79.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15141-PA 674 GK15141-PA 630..674 43..87 215 82.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15187-PA 87 GE15187-PA 1..87 1..87 457 97.7 Plus