BDGP Sequence Production Resources |
Search the DGRC for GH19585
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 195 |
Well: | 85 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13319-RA |
Protein status: | GH19585.pep: gold |
Preliminary Size: | 864 |
Sequenced Size: | 719 |
Gene | Date | Evidence |
---|---|---|
CG13319 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13319 | 2002-04-24 | Blastp of sequenced clone |
CG13319 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13319 | 2008-04-29 | Release 5.5 accounting |
CG13319 | 2008-08-15 | Release 5.9 accounting |
CG13319 | 2008-12-18 | 5.12 accounting |
719 bp (719 high quality bases) assembled on 2002-04-24
GenBank Submission: AY113349
> GH19585.complete TTTTCCTTGTGAATATTGCTTGTTTATGTATAAAATTCACGACTAATGGA TAGCGTTCCTGCGAATGTTGTGCCTGCGAAGGAGTCTGGTGGTTTCACCT CACATTGCGTCCACTTGGCGGCGGGTCCCTCGCAATTCACCGTGCGCGCC CTGAAAATGCAAGGCAGCACCATGCTGATCATAAACCCCAAGGGATTGGA GGTTTTCGAGGAGCTAGCGGTGGCCATGCCCTCTCGCAATCCCGCCAGCA GCCAGTCCCTATCCTCCACAATCCTGGGCGGACACGGGCAGACCGACTCA TCTGTTCTGGCCGCCAAATTGAGTAAACGCTACTGCCGCCAGTTCTACGT GAGCCTTAATCTCAAACTGGATCGATTAATGGGCCCTCTGTTCGAGAAGA CGCTAGTCACCTACATGCAAGACCATCTGGAGCACTTCGCTTGAGGCCCG CCTGCGCTACCGATGACACGGCGCCGCGTGGGGGTCAACGTCTATTTCGG GGACCGGCGGCTACCCCACGGACGCAGCTTCACGTACTCTACGCACTCCA TCAGCTAACTATCTGGGATCTCCGATTCCCGATCTCCGCTCAGACGTCAT GCGGCGGCCGAGTGAGCACGAACTTTAAACGTGTATCGGTGATACGAATT TTGTACAATAAATTTATTGCCCTAAGTAAGTTTACAGAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 8811229..8811672 | 1..444 | 100 | -> | Plus |
chr2R | 8811747..8811989 | 445..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RA | 1..399 | 46..444 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RB | 1..399 | 46..444 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RA | 1..399 | 46..444 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RA | 1..399 | 46..444 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RA | 1..399 | 46..444 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RA | 1..691 | 1..687 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RB | 1..687 | 1..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RB | 1..687 | 1..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RA | 1..691 | 1..687 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13319-RB | 1..687 | 1..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12923904..12924347 | 1..444 | 100 | -> | Plus |
2R | 12924422..12924664 | 445..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12923904..12924347 | 1..444 | 100 | -> | Plus |
2R | 12924422..12924664 | 445..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12923904..12924347 | 1..444 | 100 | -> | Plus |
2R | 12924422..12924664 | 445..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 8811409..8811852 | 1..444 | 100 | -> | Plus |
arm_2R | 8811927..8812169 | 445..687 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 12925103..12925546 | 1..444 | 100 | -> | Plus |
2R | 12925621..12925863 | 445..687 | 100 | Plus |
Translation from 45 to 443
> GH19585.hyp MDSVPANVVPAKESGGFTSHCVHLAAGPSQFTVRALKMQGSTMLIINPKG LEVFEELAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKLSKRYCRQF YVSLNLKLDRLMGPLFEKTLVTYMQDHLEHFA*
Translation from 45 to 443
> GH19585.pep MDSVPANVVPAKESGGFTSHCVHLAAGPSQFTVRALKMQGSTMLIINPKG LEVFEELAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKLSKRYCRQF YVSLNLKLDRLMGPLFEKTLVTYMQDHLEHFA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12928-PA | 139 | GF12928-PA | 10..138 | 3..131 | 429 | 63.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20346-PA | 132 | GG20346-PA | 1..132 | 1..132 | 628 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20304-PA | 140 | GH20304-PA | 26..139 | 17..131 | 301 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13319-PB | 132 | CG13319-PB | 1..132 | 1..132 | 671 | 100 | Plus |
CG13319-PA | 132 | CG13319-PA | 1..132 | 1..132 | 671 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19974-PA | 150 | GI19974-PA | 36..149 | 17..131 | 284 | 51.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17161-PA | 148 | GL17161-PA | 27..147 | 11..131 | 419 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12200-PA | 148 | GA12200-PA | 27..147 | 11..131 | 419 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21433-PA | 132 | GM21433-PA | 1..132 | 1..132 | 659 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10931-PA | 132 | GD10931-PA | 1..132 | 1..132 | 671 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21227-PA | 136 | GJ21227-PA | 6..135 | 2..131 | 310 | 50.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20768-PA | 138 | GK20768-PA | 23..138 | 17..132 | 471 | 73.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12505-PA | 132 | GE12505-PA | 1..132 | 1..132 | 629 | 89.4 | Plus |