Clone GH19585 Report

Search the DGRC for GH19585

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:195
Well:85
Vector:pOT2
Associated Gene/TranscriptCG13319-RA
Protein status:GH19585.pep: gold
Preliminary Size:864
Sequenced Size:719

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13319 2002-01-01 Sim4 clustering to Release 2
CG13319 2002-04-24 Blastp of sequenced clone
CG13319 2003-01-01 Sim4 clustering to Release 3
CG13319 2008-04-29 Release 5.5 accounting
CG13319 2008-08-15 Release 5.9 accounting
CG13319 2008-12-18 5.12 accounting

Clone Sequence Records

GH19585.complete Sequence

719 bp (719 high quality bases) assembled on 2002-04-24

GenBank Submission: AY113349

> GH19585.complete
TTTTCCTTGTGAATATTGCTTGTTTATGTATAAAATTCACGACTAATGGA
TAGCGTTCCTGCGAATGTTGTGCCTGCGAAGGAGTCTGGTGGTTTCACCT
CACATTGCGTCCACTTGGCGGCGGGTCCCTCGCAATTCACCGTGCGCGCC
CTGAAAATGCAAGGCAGCACCATGCTGATCATAAACCCCAAGGGATTGGA
GGTTTTCGAGGAGCTAGCGGTGGCCATGCCCTCTCGCAATCCCGCCAGCA
GCCAGTCCCTATCCTCCACAATCCTGGGCGGACACGGGCAGACCGACTCA
TCTGTTCTGGCCGCCAAATTGAGTAAACGCTACTGCCGCCAGTTCTACGT
GAGCCTTAATCTCAAACTGGATCGATTAATGGGCCCTCTGTTCGAGAAGA
CGCTAGTCACCTACATGCAAGACCATCTGGAGCACTTCGCTTGAGGCCCG
CCTGCGCTACCGATGACACGGCGCCGCGTGGGGGTCAACGTCTATTTCGG
GGACCGGCGGCTACCCCACGGACGCAGCTTCACGTACTCTACGCACTCCA
TCAGCTAACTATCTGGGATCTCCGATTCCCGATCTCCGCTCAGACGTCAT
GCGGCGGCCGAGTGAGCACGAACTTTAAACGTGTATCGGTGATACGAATT
TTGTACAATAAATTTATTGCCCTAAGTAAGTTTACAGAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

GH19585.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13319-RB 997 CG13319-RB 86..773 1..688 3440 100 Plus
CG13319-RA 789 CG13319-RA 86..777 1..688 3375 99.4 Plus
CG13319.b 1063 CG13319.b 38..712 1..675 3375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8811229..8811673 1..445 2225 100 Plus
chr2R 21145070 chr2R 8811747..8811989 445..687 1215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12923904..12924348 1..445 2225 100 Plus
2R 25286936 2R 12924422..12924665 445..688 1220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12925103..12925547 1..445 2225 100 Plus
2R 25260384 2R 12925621..12925864 445..688 1220 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:56:32 has no hits.

GH19585.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:57:18 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8811229..8811672 1..444 100 -> Plus
chr2R 8811747..8811989 445..687 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:49:20 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RA 1..399 46..444 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:36 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RB 1..399 46..444 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:22 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RA 1..399 46..444 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:56 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RA 1..399 46..444 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:23:47 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RA 1..399 46..444 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:37:32 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RA 1..691 1..687 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:35 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RB 1..687 1..687 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:22 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RB 1..687 1..687 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:56 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RA 1..691 1..687 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:23:47 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
CG13319-RB 1..687 1..687 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:18 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12923904..12924347 1..444 100 -> Plus
2R 12924422..12924664 445..687 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:18 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12923904..12924347 1..444 100 -> Plus
2R 12924422..12924664 445..687 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:18 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12923904..12924347 1..444 100 -> Plus
2R 12924422..12924664 445..687 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:22 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8811409..8811852 1..444 100 -> Plus
arm_2R 8811927..8812169 445..687 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:52 Download gff for GH19585.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12925103..12925546 1..444 100 -> Plus
2R 12925621..12925863 445..687 100   Plus

GH19585.hyp Sequence

Translation from 45 to 443

> GH19585.hyp
MDSVPANVVPAKESGGFTSHCVHLAAGPSQFTVRALKMQGSTMLIINPKG
LEVFEELAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKLSKRYCRQF
YVSLNLKLDRLMGPLFEKTLVTYMQDHLEHFA*

GH19585.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13319-PB 132 CG13319-PB 1..132 1..132 671 100 Plus
CG13319-PA 132 CG13319-PA 1..132 1..132 671 100 Plus

GH19585.pep Sequence

Translation from 45 to 443

> GH19585.pep
MDSVPANVVPAKESGGFTSHCVHLAAGPSQFTVRALKMQGSTMLIINPKG
LEVFEELAVAMPSRNPASSQSLSSTILGGHGQTDSSVLAAKLSKRYCRQF
YVSLNLKLDRLMGPLFEKTLVTYMQDHLEHFA*

GH19585.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12928-PA 139 GF12928-PA 10..138 3..131 429 63.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20346-PA 132 GG20346-PA 1..132 1..132 628 88.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20304-PA 140 GH20304-PA 26..139 17..131 301 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13319-PB 132 CG13319-PB 1..132 1..132 671 100 Plus
CG13319-PA 132 CG13319-PA 1..132 1..132 671 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19974-PA 150 GI19974-PA 36..149 17..131 284 51.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17161-PA 148 GL17161-PA 27..147 11..131 419 66.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12200-PA 148 GA12200-PA 27..147 11..131 419 66.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21433-PA 132 GM21433-PA 1..132 1..132 659 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10931-PA 132 GD10931-PA 1..132 1..132 671 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21227-PA 136 GJ21227-PA 6..135 2..131 310 50.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20768-PA 138 GK20768-PA 23..138 17..132 471 73.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12505-PA 132 GE12505-PA 1..132 1..132 629 89.4 Plus