Clone GH19623 Report

Search the DGRC for GH19623

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:196
Well:23
Vector:pOT2
Associated Gene/Transcriptboly-RA
Protein status:GH19623.pep: gold
Preliminary Size:5266
Sequenced Size:1131

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2149 2002-01-01 Sim4 clustering to Release 2
CG30362 2002-05-18 Blastp of sequenced clone
CG30362 2003-01-01 Sim4 clustering to Release 3
CG30362 2008-04-29 Release 5.5 accounting
CG30362 2008-08-15 Release 5.9 accounting
CG30362 2008-12-18 5.12 accounting

Clone Sequence Records

GH19623.complete Sequence

1131 bp (1131 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118800

> GH19623.complete
CGAGGTTTTCATAAGGACAGATATATATACATATATACTTTTTAAGGTCG
GAAACACTACCAATCTAGTAACAAGAATCGCAGCCACCCGAGTAACTTGC
TTCAAATGACAACATTTGTGGAACGATCACATTCCGTTACAACGCTCATG
ATGAAAATTTCGCAGTGACTCCCAGTTTTCGTTTATATTTTAAACCAGGA
CAAAATTTTTGCAGTGTGTACGGCATTTTTGCAACATAGTTTATACTCCA
CTTTGAATCCGGCTTCATTGAAACAATGATGCTGGCCAAGAACACGCTCT
CCCGAGCACCGGTTGCCATAAGGAGTGGATTGACGTCAAGGACCATTCAG
GTGCGCATGGAGTCGTTGTTCGATCCGTATGAATTTGGTGCGCCCACGAT
GGCCACCGAACGAAAGGATCTGAAAAAGAATGATCCCGCGGACAACACCA
AGGTGCCGGTCAAGGACATCTGCTGGATGTCGATGCGGCGCAGTGAGTAC
AAGTGCCGTTCCGACCCCGAGTTCAACGTGCCGGCCTTTATTGACTCCCG
TAAAAGATGCCTGTCCGATCGCTGTGCGATGGCCTATCCGCCGTCTGACC
TCATGTTCTACAAGCCCACCGATAAGCTGAATCGCAAGTACCAGCGCACC
TGGTGCGAGTGCGAGCTGCAGGAGCGCAAAAGGAAGGCCGTTTGCCGGTC
CCGTCCGCCCAAAATTCATCGACGGAGCCTTCGAACTCTGCCGCTCCATC
CTTCGAAGGTTTGCTCCAAAGGCAACAAGAGCCTTGGGCTGGGGCTTTGC
CGCCCGAAGCCAGCGAAGAGCTCCTGCCCCAGGTTCAAGATGCCCTTCTG
CAAGCAGGCCATTACGACCGGCTGCCGGCCAGGACGCCCCCCCTCCAATT
GCGTTCGCCCCCGGACCAAGTATCCCAGCTTTTCGGAGTGCCAACCGTAT
CCGCTTCCCGATGTTCCGCCGACGCATTGCTTCTGCATCAACCAGCCGCC
CATGTGCGTGGTTTGGAACTATTACCGCATGAAGAAATCCTAGTTGCCTA
GGTCTTCCTACAATTACCAATTGCCAAACCTAAGATTCGAATAAACAATA
GGATATACATTAAAAAAAAAAAAAAAAAAAA

GH19623.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
boly-RA 1112 boly-RA 1..1112 1..1112 5560 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4253076..4254184 1111..3 5530 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:59:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8365549..8366660 1112..1 5560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8366748..8367859 1112..1 5560 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:45:17 has no hits.

GH19623.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:46:19 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4253076..4254125 62..1111 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:49:24 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
CG30362-RA 1..768 276..1043 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:04 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
boly-RA 1..768 276..1043 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:24 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
boly-RA 1..768 276..1043 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:20 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
CG30362-RA 1..768 276..1043 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:47:26 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
boly-RA 1..768 276..1043 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:36 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
CG30362-RA 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:04 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
boly-RA 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:24 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
boly-RA 29..1139 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:20 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
CG30362-RA 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:47:26 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
boly-RA 29..1139 1..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:19 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8365550..8366660 1..1111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:19 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8365550..8366660 1..1111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:46:19 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8365550..8366660 1..1111 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:24 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4253055..4254165 1..1111 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:42 Download gff for GH19623.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8366749..8367859 1..1111 100   Minus

GH19623.pep Sequence

Translation from 275 to 1042

> GH19623.pep
MMLAKNTLSRAPVAIRSGLTSRTIQVRMESLFDPYEFGAPTMATERKDLK
KNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKRCLSDRC
AMAYPPSDLMFYKPTDKLNRKYQRTWCECELQERKRKAVCRSRPPKIHRR
SLRTLPLHPSKVCSKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQAITTGC
RPGRPPSNCVRPRTKYPSFSECQPYPLPDVPPTHCFCINQPPMCVVWNYY
RMKKS*

GH19623.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19807-PA 244 GF19807-PA 31..244 42..255 512 49.8 Plus
Dana\GF14894-PA 253 GF14894-PA 8..248 3..253 412 42.2 Plus
Dana\GF13522-PA 226 GF13522-PA 34..221 67..251 167 32.5 Plus
Dana\GF13521-PA 277 GF13521-PA 71..257 77..255 160 30.7 Plus
Dana\GF12596-PA 309 GF12596-PA 145..285 108..249 152 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10650-PA 256 GG10650-PA 1..256 1..255 1123 83.2 Plus
Dere\GG25129-PA 248 GG25129-PA 12..244 21..251 411 45.2 Plus
Dere\GG22409-PA 239 GG22409-PA 3..239 23..255 205 30.8 Plus
Dere\GG23352-PA 244 GG23352-PA 69..233 83..255 179 31.5 Plus
Dere\GG10647-PA 303 GG10647-PA 146..287 108..251 171 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20818-PA 177 GH20818-PA 4..177 87..255 306 44 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
boly-PA 255 CG30362-PA 1..255 1..255 1417 100 Plus
CG4691-PA 262 CG4691-PA 41..260 33..253 487 47.3 Plus
CG12861-PA 239 CG12861-PA 50..237 64..253 255 33.5 Plus
CG2127-PB 289 CG2127-PB 89..275 45..253 222 30.7 Plus
CG2127-PA 305 CG2127-PA 105..291 45..253 222 30.7 Plus
CG8701-PA 246 CG8701-PA 64..223 78..244 219 31.6 Plus
CG33340-PA 229 CG33340-PA 73..224 95..253 206 33.9 Plus
CG12860-PA 316 CG12860-PA 118..297 77..249 205 31.1 Plus
hubl-PB 291 CG30364-PB 132..267 108..244 177 33.6 Plus
hubl-PA 291 CG30364-PA 132..267 108..244 177 33.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20915-PA 272 GI20915-PA 56..272 42..255 444 44.7 Plus
Dmoj\GI20909-PA 248 GI20909-PA 73..226 88..246 156 34 Plus
Dmoj\GI20912-PA 250 GI20912-PA 96..234 108..251 146 34.4 Plus
Dmoj\GI18687-PA 297 GI18687-PA 134..268 104..238 145 34 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10869-PA 261 GL10869-PA 50..261 46..255 507 54 Plus
Dper\GL11217-PA 243 GL11217-PA 67..222 82..247 162 30 Plus
Dper\GL10866-PA 259 GL10866-PA 102..243 108..251 145 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15789-PA 261 GA15789-PA 50..261 46..255 508 51.8 Plus
Dpse\GA21267-PA 243 GA21267-PA 67..222 82..247 162 30 Plus
Dpse\GA15259-PA 259 GA15259-PA 102..243 108..251 145 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20695-PA 252 GM20695-PA 1..252 1..255 1226 92.5 Plus
Dsec\GM15754-PA 262 GM15754-PA 41..258 33..251 403 47.2 Plus
Dsec\GM20195-PA 239 GM20195-PA 3..237 23..253 202 29.5 Plus
Dsec\GM20692-PA 305 GM20692-PA 146..289 108..251 163 33.3 Plus
Dsec\GM21027-PA 246 GM21027-PA 64..223 78..244 157 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15278-PA 252 GD15278-PA 1..252 1..255 1226 92.5 Plus
Dsim\GD23976-PA 262 GD23976-PA 41..258 33..251 401 47.2 Plus
Dsim\GD25666-PA 239 GD25666-PA 3..237 23..253 202 29.5 Plus
Dsim\GD15275-PA 305 GD15275-PA 146..289 108..251 170 34 Plus
Dsim\GD21095-PA 232 GD21095-PA 90..225 108..251 150 34.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20644-PA 206 GJ20644-PA 1..206 49..255 455 47 Plus
Dvir\GJ20645-PA 276 GJ20645-PA 65..276 46..255 451 48.4 Plus
Dvir\GJ21490-PA 242 GJ21490-PA 58..242 66..254 197 34 Plus
Dvir\GJ20639-PA 249 GJ20639-PA 62..225 71..244 149 31.3 Plus
Dvir\GJ20641-PA 249 GJ20641-PA 95..233 108..251 148 35.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15755-PA 265 GK15755-PA 17..265 8..255 445 44.5 Plus
Dwil\GK15825-PA 289 GK15825-PA 129..273 105..251 196 38.2 Plus
Dwil\GK19521-PA 232 GK19521-PA 8..232 26..255 177 32.4 Plus
Dwil\GK19520-PA 203 GK19520-PA 50..197 108..251 160 32.9 Plus
Dwil\GK15752-PA 216 GK15752-PA 42..205 83..255 156 30.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23091-PA 256 GE23091-PA 1..256 1..255 1068 81.2 Plus
Dyak\GE19047-PA 239 GE19047-PA 2..235 21..251 398 44.3 Plus
Dyak\GE12298-PA 239 GE12298-PA 3..237 23..253 224 32 Plus
Dyak\GE19192-PA 245 GE19192-PA 64..223 78..244 178 32.8 Plus
Dyak\GE23064-PA 307 GE23064-PA 148..291 108..251 173 35.3 Plus

GH19623.hyp Sequence

Translation from 275 to 1042

> GH19623.hyp
MMLAKNTLSRAPVAIRSGLTSRTIQVRMESLFDPYEFGAPTMATERKDLK
KNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKRCLSDRC
AMAYPPSDLMFYKPTDKLNRKYQRTWCECELQERKRKAVCRSRPPKIHRR
SLRTLPLHPSKVCSKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQAITTGC
RPGRPPSNCVRPRTKYPSFSECQPYPLPDVPPTHCFCINQPPMCVVWNYY
RMKKS*

GH19623.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
boly-PA 255 CG30362-PA 1..255 1..255 1417 100 Plus
CG4691-PA 262 CG4691-PA 41..260 33..253 487 47.3 Plus
CG12861-PA 239 CG12861-PA 50..237 64..253 255 33.5 Plus
CG2127-PB 289 CG2127-PB 89..275 45..253 222 30.7 Plus
CG2127-PA 305 CG2127-PA 105..291 45..253 222 30.7 Plus