BDGP Sequence Production Resources |
Search the DGRC for GH19864
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 198 |
Well: | 64 |
Vector: | pOT2 |
Associated Gene/Transcript | lsn-RA |
Protein status: | GH19864.pep: gold |
Sequenced Size: | 873 |
Gene | Date | Evidence |
---|---|---|
CG6637 | 2005-07-27 | Manual selection by Sue Celniker |
CG6637 | 2008-04-29 | In process prior to 5.5 |
CG6637 | 2008-08-15 | Release 5.9 accounting |
CG6637 | 2008-12-18 | 5.12 accounting |
873 bp assembled on 2008-05-14
GenBank Submission: BT032686
> GH19864.complete CAAATATAAACTTAAGGAACAGCTATGCGACGACGTGTAGGCCTGGGAGC CATACAGCAGCAGAAGCTGGCTGCGGAGAAGTACAAGGACAAGGGCACCG ATCTGCAGGAAAACCAACTCGAACAGATGACCAAGCAAATGGAGGTATTC CGGGTGAAACTCGAGGAATTTGCGATGAAACACAAGGAGGACATACGCAA GAATTCGCAGTTCCGCAAACAGTTTCAGGAAATGTGCGCCGCCATCGGCG TGGATCCGCTGGCCACCGGTAAAGGATTCTGGAGCGTTCTGGGAATGGGC GATTTCTACTACGAACTGGGCGTCCAGGTGGTGGAGGTTTGTCTAGCTGC CAATCACAAAACCGGTGGACTTATGGAGCTGGACGATCTGCGACGTCGGC TAATCGCCGCCAGAGGTCAGAGTTCAGTGCACCAGGAGATCACCAAGGAG GACATCCTAATGGCCGCTAAGAAATTGAGCATTTTTGGCAACGGCTTTGT GGTTCACAAGCTGGGCAAGGGCAAGTACATAGTTCAGTCCATTCCCGGAG AGCTGAGCATGGAGGAGACCAACATACTGAATGCCGCATCCAATACCGAA CAAGGCTGTGTTACGCAGAGTCAGCTGATCAAGGATTTGGGCTGGACCGA CTATCGTGCTCAACAGTCACTGGACAAGGTGCTCGGCGAAGGTCTCTGTT GGATTGACAAGCAGGCGGGCGATGAGCCAGCCTATTGGTTTCCCAGTTTG TTTCCCGGTCGAAACGCACAGACAACGGCCGCCACATAGTGTGATCTCGT AGAACTAATTTATTATGTACGAGAGTTATCATAAAATATATATTTGTACA ACCGTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 17688961..17689454 | 1..494 | 2440 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 17689731..17689945 | 641..855 | 1060 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 17689521..17689668 | 494..641 | 710 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 21865254..21865747 | 1..494 | 2470 | 100 | Plus |
3R | 32079331 | 3R | 21866024..21866242 | 641..859 | 1095 | 100 | Plus |
3R | 32079331 | 3R | 21865814..21865961 | 494..641 | 740 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 21606085..21606578 | 1..494 | 2470 | 100 | Plus |
3R | 31820162 | 3R | 21606855..21607073 | 641..859 | 1095 | 100 | Plus |
3R | 31820162 | 3R | 21606645..21606792 | 494..641 | 740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 17688961..17689454 | 1..494 | 99 | -> | Plus |
chr3R | 17689522..17689668 | 495..641 | 98 | -> | Plus |
chr3R | 17689732..17689945 | 642..855 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6637-RA | 1..765 | 25..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lsn-RA | 1..765 | 25..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lsn-RA | 1..765 | 25..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6637-RA | 1..765 | 25..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lsn-RA | 1..765 | 25..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6637-RA | 55..843 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lsn-RA | 55..909 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lsn-RA | 87..941 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6637-RA | 55..843 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lsn-RA | 87..941 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21865254..21865747 | 1..494 | 100 | -> | Plus |
3R | 21865815..21865961 | 495..641 | 100 | -> | Plus |
3R | 21866025..21866238 | 642..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21865254..21865747 | 1..494 | 100 | -> | Plus |
3R | 21865815..21865961 | 495..641 | 100 | -> | Plus |
3R | 21866025..21866238 | 642..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21865254..21865747 | 1..494 | 100 | -> | Plus |
3R | 21865815..21865961 | 495..641 | 100 | -> | Plus |
3R | 21866025..21866238 | 642..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 17690976..17691469 | 1..494 | 100 | -> | Plus |
arm_3R | 17691537..17691683 | 495..641 | 100 | -> | Plus |
arm_3R | 17691747..17691960 | 642..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 21606085..21606578 | 1..494 | 100 | -> | Plus |
3R | 21606646..21606792 | 495..641 | 100 | -> | Plus |
3R | 21606856..21607069 | 642..855 | 100 | Plus |
Translation from 24 to 788
> GH19864.hyp MRRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFA MKHKEDIRKNSQFRKQFQEMCAAIGVDPLATGKGFWSVLGMGDFYYELGV QVVEVCLAANHKTGGLMELDDLRRRLIAARGQSSVHQEITKEDILMAAKK LSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGCVTQSQ LIKDLGWTDYRAQQSLDKVLGEGLCWIDKQAGDEPAYWFPSLFPGRNAQT TAAT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lsn-PA | 254 | CG6637-PA | 1..254 | 1..254 | 1315 | 100 | Plus |
Translation from 24 to 788
> GH19864.pep MRRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFA MKHKEDIRKNSQFRKQFQEMCAAIGVDPLATGKGFWSVLGMGDFYYELGV QVVEVCLAANHKTGGLMELDDLRRRLIAARGQSSVHQEITKEDILMAAKK LSIFGNGFVVHKLGKGKYIVQSIPGELSMEETNILNAASNTEQGCVTQSQ LIKDLGWTDYRAQQSLDKVLGEGLCWIDKQAGDEPAYWFPSLFPGRNAQT TAAT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18047-PA | 255 | GF18047-PA | 1..252 | 1..254 | 1258 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11084-PA | 255 | GG11084-PA | 1..254 | 1..254 | 1256 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16290-PA | 253 | GH16290-PA | 1..253 | 1..253 | 1220 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lsn-PA | 254 | CG6637-PA | 1..254 | 1..254 | 1315 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22186-PA | 253 | GI22186-PA | 1..253 | 1..253 | 1233 | 89.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23796-PA | 253 | GL23796-PA | 1..252 | 1..252 | 1290 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19743-PA | 253 | GA19743-PA | 1..252 | 1..252 | 1294 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26377-PA | 254 | GM26377-PA | 1..254 | 1..254 | 1353 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20899-PA | 254 | GD20899-PA | 1..254 | 1..254 | 1354 | 99.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24305-PA | 253 | GJ24305-PA | 1..253 | 1..253 | 1234 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14228-PA | 254 | GK14228-PA | 1..254 | 1..254 | 1265 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10244-PA | 254 | GE10244-PA | 1..254 | 1..254 | 1343 | 98.4 | Plus |