Clone GH20124 Report

Search the DGRC for GH20124

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:201
Well:24
Vector:pOT2
Associated Gene/Transcriptsoti-RA
Protein status:GH20124.pep: gold
Preliminary Size:1149
Sequenced Size:1023

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8489 2001-01-01 Release 2 assignment
CG8489 2003-01-01 Sim4 clustering to Release 3
CG8489 2003-05-21 Blastp of sequenced clone
CG8489 2008-04-29 Release 5.5 accounting
CG8489 2008-08-15 Release 5.9 accounting
CG8489 2008-12-18 5.12 accounting

Clone Sequence Records

GH20124.complete Sequence

1023 bp (1023 high quality bases) assembled on 2003-05-21

GenBank Submission: AY060750

> GH20124.complete
ACAAAACGACACAACTGATACTACAGAGAAAAAAACATCGTATTGAATAG
CAGAAGCACAACCTACACTGCCGTATTTATTGTTCAATTTTTGTTGGTTG
TTTTTTTTTTTTTTGTATGTGCCTGTAAGTTGGAATGGACGTACTACACG
GACACGATCTGTACGATGAGCAGCTAATCGATCGAGTCGGCGACGCGGTG
AATGAAGATGCTGGCGATGACTTGGACACATTGGAGGATGGACAGCAGCA
GCAGCGCCTGGGAGTCAATCGTCAGATGGACATACTCCTGGACGCTCCTC
AAGAGCCACCGTTGGGCGTTTTTCCGGCGCAAGGAGGGCCAAATGGACCA
CCACGTCGGCGGAAGAAACGAAGTTTCTACACTATGACCAAACCCACTCC
GCCATGCCAAAGTCAGGAGCCGGAGATGTGCCTCCTAATGGCCAGTGTCA
CGAGGGCAATGCGTCACGTTCGCGAGGATCAGCGAGGCGAGTACTTTGCA
AATTACCTCGTCGAGAATATGACCAGTCAGAACTACCCGAATGGTATGGG
TCTGCCACAGCATTGGGGTCAGTTCTGATTCGCCATAGTTCTCCCATAGA
TTGTAAATTAGAAGAACCTCTCTTGGACCTCGGAAGATCGAGCAAGCTCA
TTGGGATCCCATACTACACATACATGTACACGTCCATATATCCAACCAGC
CGATATGCATCCCATTAGTTATCTTTCCTCTAAAAACTTGCTCAAAACAA
AAATACGTTACACCATAGTTATCTACCGCTCCACCAAGCTCAAAAAAGGA
AAAAAAGACGTTACTTTACTGACTTACAGTTGAAAAATGTTTGCGGTTCA
ATCTTGTTCAATAAACAACACGATTTAGCAAACTTATATTTTCATATTTG
GTTTTCAACTTATTGTTTTCCAAATTTATTCTACAATTGTTAACAAACCA
CATAATATATAAGTACCACATATATGTTAATAAAAACCGAATGATTTATC
TAAAAAAAAAAAAAAAAAAAAAA

GH20124.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
soti-RA 1317 soti-RA 38..1040 1..1004 4980 99.9 Plus
soti.b 1272 soti.b 38..579 1..543 2675 99.8 Plus
soti.a 1285 soti.a 62..603 1..543 2675 99.8 Plus
soti.b 1272 soti.b 579..995 588..1004 2085 100 Plus
soti.a 1285 soti.a 603..1008 599..1004 2030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10205453..10206452 1001..1 4940 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:00:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14380660..14381662 1004..1 4970 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14121491..14122493 1004..1 4980 99.9 Minus
Blast to na_te.dros performed 2019-03-15 21:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 2430..2482 904..956 112 67.9 Plus

GH20124.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:45:10 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10205453..10206452 1..1001 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:06 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
CG8489-RA 1..444 135..578 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:35:57 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
soti-RA 1..444 135..578 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:57:02 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
soti-RA 1..444 135..578 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:11:52 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
CG8489-RA 1..444 135..578 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:51 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
soti-RA 1..444 135..578 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:39:06 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
CG8489-RA 38..1037 1..1001 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:35:56 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
soti-RA 38..1037 1..1001 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:57:02 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
soti-RA 38..1037 1..1001 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:11:52 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
CG8489-RA 38..1037 1..1001 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:51 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
soti-RA 38..1037 1..1001 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:10 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14380663..14381662 1..1001 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:10 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14380663..14381662 1..1001 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:10 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14380663..14381662 1..1001 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:57:02 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10206385..10207384 1..1001 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:48:18 Download gff for GH20124.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14121494..14122493 1..1001 99   Minus

GH20124.hyp Sequence

Translation from 134 to 577

> GH20124.hyp
MDVLHGHDLYDEQLIDRVGDAVNEDAGDDLDTLEDGQQQQRLGVNRQMDI
LLDAPQEPPLGVFPAQGGPNGPPRRRKKRSFYTMTKPTPPCQSQEPEMCL
LMASVTRAMRHVREDQRGEYFANYLVENMTSQNYPNGMGLPQHWGQF*

GH20124.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
soti-PA 147 CG8489-PA 1..147 1..147 800 100 Plus

GH20124.pep Sequence

Translation from 134 to 577

> GH20124.pep
MDVLHGHDLYDEQLIDRVGDAVNEDAGDDLDTLEDGQQQQRLGVNRQMDI
LLDAPQEPPLGVFPAQGGPNGPPRRRKKRSFYTMTKPTPPCQSQEPEMCL
LMASVTRAMRHVREDQRGEYFANYLVENMTSQNYPNGMGLPQHWGQF*

GH20124.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17485-PA 183 GF17485-PA 13..167 11..147 336 48.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21338-PA 156 GG21338-PA 1..156 1..147 622 78.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13685-PA 150 GH13685-PA 32..150 27..147 251 44.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
soti-PA 147 CG8489-PA 1..147 1..147 800 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24808-PA 152 GI24808-PA 42..152 33..147 252 47 Plus
Dmoj\GI21834-PA 152 GI21834-PA 42..152 33..147 246 46.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24018-PA 133 GL24018-PA 38..133 48..147 187 42 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21112-PA 133 GA21112-PA 38..133 48..147 191 43 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25856-PA 148 GM25856-PA 1..148 1..147 737 94.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20424-PA 147 GD20424-PA 1..147 1..147 736 93.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24453-PA 158 GJ24453-PA 48..158 33..147 257 47.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12151-PA 145 GK12151-PA 47..145 45..147 255 50.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26454-PA 196 GE26454-PA 1..147 1..144 611 83.2 Plus