Clone GH20208 Report

Search the DGRC for GH20208

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:202
Well:8
Vector:pOT2
Associated Gene/TranscriptCG9483-RA
Protein status:GH20208.pep: gold
Preliminary Size:1102
Sequenced Size:939

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9483 2001-01-01 Release 2 assignment
CG9483 2001-10-10 Blastp of sequenced clone
CG9483 2003-01-01 Sim4 clustering to Release 3
CG9483 2008-04-29 Release 5.5 accounting
CG9483 2008-08-15 Release 5.9 accounting
CG9483 2008-12-18 5.12 accounting

Clone Sequence Records

GH20208.complete Sequence

939 bp (939 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060751

> GH20208.complete
AAAGATTTGAATTTGTTTCGAGCAATAAAGTCAAGAAATCGATAATTGGA
ATTTTATCAACTCTGGTATTTCCTAGTCCAATGCCAAGTATTCAAAAAAA
CACTTTTCGGAACATCGATCAGGAGGTCTATGGCGAGCCACCGGATGAGA
GCATCAGTCATGCGGCCAAGATATACGGACTTAGTGTGATCCTGGCCGCC
ATCGCATTGACACAGTGGATCATTATAGGTTACACCCATATGCTGAGCCA
CAGCAGATCGGAGGAGCGCTACGGCTGGTGGCTTCTGTGTACCTTTTTCG
CAGTCGCCACTTTATCGTGGACCAAGCTAGGACGCAAGGTGCCCTTTAAC
TACATCATTATCGCAGCGATCGTGGAAAGCTCAACTATTTATATAGCCAT
GGAACAGAAGCACAATGAGAATAGACTCGTCAACTTCTACGCCGGCATTG
TAGTGGTTGCCTTGATGTTGGCCTCGATATTTTGGGGCGCCTACTTTCCC
ATGTTCATTGTTCCCGGTGATCTGCTGCTCAGCTGTTTGGTGGCAATAGC
CAACATTATGATGATCATATTCTTTATCAATGTCCTATTTATCAACTACC
AGGGAATATATTTTGCGGTTCGGAACACATTCGCCCTGGTGGCCGTCTGC
ATGGTGATGTACACGGCTACCATAATCCATGATCGCCAGTTCGATGTGCC
CAAGAACGAGTACTTGTTCCTCAGTGTCCTGCAGTTTTTCTCCTACATGA
TCCTGCACGAACGCATCCTGGCCATATCCTTTACAAGTGCGCTCAAAACA
AGTTGTTAAATGCAATTCTCTTTTGGCAGTCGTATGCAATTCGGTAAATC
TTAAAATTTTGTTTGCAAGTGGTTACTAAAATAAACTGTATGAAAACTAG
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH20208.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG9483-RA 921 CG9483-RA 21..921 1..901 4505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8865695..8866594 1..900 4350 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:00:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8866787..8867687 1..901 4505 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8866787..8867687 1..901 4505 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:48:09 has no hits.

GH20208.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:48:52 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8865695..8866594 1..900 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:12 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 1..729 81..809 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:51:31 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 1..729 81..809 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:48 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 1..729 81..809 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:40 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 1..729 81..809 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:53 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 1..729 81..809 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:36:24 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 21..920 1..900 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:51:31 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 21..920 1..900 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:48 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 21..920 1..900 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:41 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 21..920 1..900 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:53 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
CG9483-RA 21..920 1..900 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:52 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8866787..8867686 1..900 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:52 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8866787..8867686 1..900 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:52 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8866787..8867686 1..900 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:48 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8866787..8867686 1..900 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:20 Download gff for GH20208.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8866787..8867686 1..900 100   Plus

GH20208.hyp Sequence

Translation from 2 to 808

> GH20208.hyp
RFEFVSSNKVKKSIIGILSTLVFPSPMPSIQKNTFRNIDQEVYGEPPDES
ISHAAKIYGLSVILAAIALTQWIIIGYTHMLSHSRSEERYGWWLLCTFFA
VATLSWTKLGRKVPFNYIIIAAIVESSTIYIAMEQKHNENRLVNFYAGIV
VVALMLASIFWGAYFPMFIVPGDLLLSCLVAIANIMMIIFFINVLFINYQ
GIYFAVRNTFALVAVCMVMYTATIIHDRQFDVPKNEYLFLSVLQFFSYMI
LHERILAISFTSALKTSC*

GH20208.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9483-PA 242 CG9483-PA 1..242 27..268 1247 100 Plus

GH20208.pep Sequence

Translation from 80 to 808

> GH20208.pep
MPSIQKNTFRNIDQEVYGEPPDESISHAAKIYGLSVILAAIALTQWIIIG
YTHMLSHSRSEERYGWWLLCTFFAVATLSWTKLGRKVPFNYIIIAAIVES
STIYIAMEQKHNENRLVNFYAGIVVVALMLASIFWGAYFPMFIVPGDLLL
SCLVAIANIMMIIFFINVLFINYQGIYFAVRNTFALVAVCMVMYTATIIH
DRQFDVPKNEYLFLSVLQFFSYMILHERILAISFTSALKTSC*

GH20208.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15550-PA 321 GF15550-PA 1..234 1..233 905 70.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25310-PA 242 GG25310-PA 1..242 1..242 1193 93.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13868-PA 241 GH13868-PA 2..235 10..242 648 54.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9483-PA 242 CG9483-PA 1..242 1..242 1247 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17420-PA 241 GI17420-PA 5..235 13..242 630 53.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25574-PA 237 GL25574-PA 5..234 13..242 689 58.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21821-PA 237 GA21821-PA 5..234 13..242 689 58.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17217-PA 242 GM17217-PA 1..242 1..242 1263 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23571-PA 242 GD23571-PA 1..242 1..242 1269 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18355-PA 244 GJ18355-PA 7..235 15..242 673 57.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24534-PA 242 GK24534-PA 3..230 10..233 688 61.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18800-PA 242 GE18800-PA 1..242 1..242 1138 88.4 Plus