Clone GH20409 Report

Search the DGRC for GH20409

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:204
Well:9
Vector:pOT2
Associated Gene/TranscriptCG3557-RA
Protein status:GH20409.pep: gold
Preliminary Size:1069
Sequenced Size:973

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3557 2001-01-01 Release 2 assignment
CG3557 2001-10-10 Blastp of sequenced clone
CG3557 2003-01-01 Sim4 clustering to Release 3
CG3557 2008-04-29 Release 5.5 accounting
CG3557 2008-08-15 Release 5.9 accounting
CG3557 2008-12-18 5.12 accounting

Clone Sequence Records

GH20409.complete Sequence

973 bp (973 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060753

> GH20409.complete
CTTTTTGGGAGAATATCATTTGGAAAAATTGGGTGTTTATTTATACCAAC
ACTAGCAGACGAAACCATGAAATCCTGTTGTGCCACTCAGACGACGCGTT
GTGAGTGTCCAACGGGTCTCAGATTGGGGAAGAAGCCGCAGGCTCCACTC
TTCGACATGCTGGGCCCGCATCCAGATGAGGTCATCATGACGATCCTGGA
CCGCATCCTCTATCTTTCGGGCGCCACGAAAATAATTCCATTGCTGGAGT
TGTCGAATGAAGGATCAGCTTTTAAGAAGGAATCCTGCCCACCACCAGCA
CCCTGTGCACCAAGCCCTTGCAGTTCCGGAAGCAGCTCGGCTTATCCATC
TTCATCGGCCTGGAGTACATGCTGCTCCAAGCCGTCGACTATCTGTTGTT
ATCCCAAGCCAACGAGATGCTGCGCCAGTCCAAAAGCTCCACTAGTGCCC
TGCAGTCCAATGGATACTCCGAAATCTTCCTGCTTCAAGACCGCGAGTCG
GCTTAGTTCCGCTGCCTGTTGTCCCCGCCAGCGTACTCCCAGGGTGGACT
TCGATCACCCGGCGGAGGATATTCCGTTGAGAAATAAGGCGGGCAGCGCC
ACGATAAGGGAACAGATAAGCCGATCAATTTCCACCTGCTCGGTGGCCTG
TCAACAGCTGAAAGACAAGCTTACATCCCAGATTGCCCAAGGACACAAGG
ACCAAAAGTGGTTGTGGACCCGTTTGATTCGTGGCAACGATGGGTGCATG
GTGTACGAGGTGTACAAGGATTCCGATGTAGACAACTCTCCCTCTAAGAT
CGGGTCGGAGGCACCCATCATCCTTTTTCTAGTCATGCCGAATGGTTGCA
TCATGCCCTTTGAGTCTATTTGTGGTCCTTAGGAAGATGGTACTCGTTTT
GTATACTTTTTAGCCTGTGGTCAGTTAAAAATAAACTTTCACCCGTACTT
TGTAAAAAAAAAAAAAAAAAAAA

GH20409.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3557-RA 1048 CG3557-RA 96..1048 1..953 4765 100 Plus
CG3557.a 985 CG3557.a 39..985 1..953 4650 99.3 Plus
CG3557.b 941 CG3557.b 285..941 297..953 3285 100 Plus
CG3557.b 941 CG3557.b 25..286 1..262 1310 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2384462..2385154 953..261 3420 99.6 Minus
chr2L 23010047 chr2L 2385208..2385470 263..1 1300 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:00:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2384760..2385453 954..261 3470 100 Minus
2L 23513712 2L 2385506..2385768 263..1 1315 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2384760..2385453 954..261 3470 100 Minus
2L 23513712 2L 2385506..2385768 263..1 1315 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:44:00 has no hits.

GH20409.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:45:02 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2384462..2385152 263..953 99 <- Minus
chr2L 2385209..2385470 1..262 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:23 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 1..816 67..882 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:51:33 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 1..816 67..882 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:22 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 1..816 67..882 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:20:42 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 1..816 67..882 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:13 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 1..816 67..882 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:36:26 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 25..977 1..953 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:51:33 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 25..977 1..953 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:22 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 25..977 1..953 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:20:42 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 25..977 1..953 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:13 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
CG3557-RA 25..977 1..953 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:02 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2384761..2385451 263..953 100 <- Minus
2L 2385507..2385768 1..262 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:02 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2384761..2385451 263..953 100 <- Minus
2L 2385507..2385768 1..262 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:02 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2384761..2385451 263..953 100 <- Minus
2L 2385507..2385768 1..262 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:22 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2385507..2385768 1..262 100   Minus
arm_2L 2384761..2385451 263..953 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:22 Download gff for GH20409.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2384761..2385451 263..953 100 <- Minus
2L 2385507..2385768 1..262 100   Minus

GH20409.hyp Sequence

Translation from 0 to 881

> GH20409.hyp
LFGRISFGKIGCLFIPTLADETMKSCCATQTTRCECPTGLRLGKKPQAPL
FDMLGPHPDEVIMTILDRILYLSGATKIIPLLELSNEGSAFKKESCPPPA
PCAPSPCSSGSSSAYPSSSAWSTCCSKPSTICCYPKPTRCCASPKAPLVP
CSPMDTPKSSCFKTASRLSSAACCPRQRTPRVDFDHPAEDIPLRNKAGSA
TIREQISRSISTCSVACQQLKDKLTSQIAQGHKDQKWLWTRLIRGNDGCM
VYEVYKDSDVDNSPSKIGSEAPIILFLVMPNGCIMPFESICGP*

GH20409.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3557-PA 271 CG3557-PA 1..271 23..293 1479 100 Plus
CG3557-PB 269 CG3557-PB 1..269 23..293 1456 99.3 Plus
CG3557-PC 259 CG3557-PC 1..259 23..293 1387 95.6 Plus

GH20409.pep Sequence

Translation from 66 to 881

> GH20409.pep
MKSCCATQTTRCECPTGLRLGKKPQAPLFDMLGPHPDEVIMTILDRILYL
SGATKIIPLLELSNEGSAFKKESCPPPAPCAPSPCSSGSSSAYPSSSAWS
TCCSKPSTICCYPKPTRCCASPKAPLVPCSPMDTPKSSCFKTASRLSSAA
CCPRQRTPRVDFDHPAEDIPLRNKAGSATIREQISRSISTCSVACQQLKD
KLTSQIAQGHKDQKWLWTRLIRGNDGCMVYEVYKDSDVDNSPSKIGSEAP
IILFLVMPNGCIMPFESICGP*

GH20409.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14404-PA 258 GF14404-PA 13..256 12..268 582 47 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24524-PA 265 GG24524-PA 1..265 1..271 1059 78.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19620-PA 248 GH19620-PA 32..245 28..268 356 39.4 Plus
Dgri\GH11503-PA 248 GH11503-PA 34..245 30..268 348 38.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG3557-PA 271 CG3557-PA 1..271 1..271 1479 100 Plus
CG3557-PB 269 CG3557-PB 1..269 1..271 1456 99.3 Plus
CG3557-PC 259 CG3557-PC 1..259 1..271 1387 95.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16999-PA 262 GI16999-PA 27..259 17..268 342 39.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26470-PA 260 GL26470-PA 17..257 18..268 481 44.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17518-PA 260 GA17518-PA 17..257 18..268 481 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18232-PA 140 GM18232-PA 1..140 132..271 698 93.6 Plus
Dsec\GM18231-PA 121 GM18231-PA 1..65 1..65 330 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22838-PA 266 GD22838-PA 1..266 1..271 1104 87.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24237-PA 255 GJ24237-PA 2..252 3..268 447 42.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23740-PA 144 GK23740-PA 9..107 2..109 153 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15115-PA 270 GE15115-PA 1..270 1..271 1054 81.2 Plus