Clone GH20441 Report

Search the DGRC for GH20441

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:204
Well:41
Vector:pOT2
Associated Gene/TranscriptCG4691-RA
Protein status:GH20441.pep: gold
Preliminary Size:1288
Sequenced Size:1125

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4691 2001-01-01 Release 2 assignment
CG4691 2002-06-12 Blastp of sequenced clone
CG4691 2003-01-01 Sim4 clustering to Release 3
CG4691 2008-04-29 Release 5.5 accounting
CG4691 2008-08-15 Release 5.9 accounting
CG4691 2008-12-18 5.12 accounting

Clone Sequence Records

GH20441.complete Sequence

1125 bp (1125 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122122

> GH20441.complete
CACATCTAAAACAAAAAAATGCGGTGCGGTCAGTAGTTAAATTGCGAAAT
TGAAATCGAAGTAAGCTCGTGGCGTCTTACCAGTTTTACCCAAAATTATC
TCGTTTTGATTTGAAGACTCGCTGCAAAATAATTTTAATCAAACAAAATT
AAAATGCTTGCCAAAAGCAAACCGCTGATTGGCATGTCTCACTTGCTGCA
AAAGCAGGTTTTAGGCTTTCTGCCTCCGTCTTCGTTTCGCCACTTTAACT
CCGAGGGCAATTTGTACTCCCAGGATGGCTGGGAGAGTGGCTATCCGGCG
CCCTTGCTGCCGCGCAAGGACCTAAAGCCGTTGGAGAAGAAAGACAGATC
AAAGGTATACGATGCCTGTTGGCAAACGACGCGGCGGACCGAATACAAGT
GCCGTTCGGATCCAGAGTTTCAGATGCACGCCTTTATCGATTCGCGCAAA
AGTTGTTTAGAAGACCCCTGCGCCACCGAGATGTTGGCCATCGATCTCAC
CCACTATAAGCCCTCGGACATGGGCAAACGAAAGTATCCGCGCACCTGGT
TCGAATGTGTGGTCAAGCGGCGGAAGCGGAAGGCCCACTGCGTCCCCGTA
CCGCCACCGATGCCGCGGCGCAAGCGCAAGTCGAAAAAGCCCCGCTGCCC
CGAGGATTTGTGTGTATTGGGCAAACTGGAGCTTAACCTCATCAAACCCT
GCGTTAAGGAATCATCGAAATGTCCGCGCTTCAGAATGCCCAACTGCTGT
GTGGCCGCCCGCGATCCGCCCAAGTGCCGTCGTCCCTTTAGACGTTGTGG
CCAGAGACCCAAGACCAAGTATCCAAGTTTCTCCGAGTGTCGACGCGATC
CCTTCCCGGATCCTCGACCCATCGAGTGCAACTGCCTGCTCAAGCCGGCC
ATCTGCGATATGTGGCGCCACTACCGCCGCCGATTTGGCTAATCAACTTC
GATTTCACCAAAGGATTTTTACCAAGTTTTGACCGAACTAAATTAATGTC
GCGAGGCCTATCGCAACAAAAGATGCTTTCGCATTTTGAGAGCATATGAC
AATTCTATCCCAACTATGTGTTGTGTCATGCTCGTATTAAAGAACTATAC
AAATATTAAAAAAAAAAAAAAAAAA

GH20441.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4691-RA 1167 CG4691-RA 52..1163 1..1112 5545 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14759539..14760645 1..1107 5520 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:00:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14760818..14761929 1..1112 5545 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14760818..14761929 1..1112 5545 99.9 Plus
Blast to na_te.dros performed 2019-03-15 23:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 509..553 126..170 126 75.6 Plus

GH20441.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:50:02 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14759539..14760645 1..1107 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:25 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 1..789 154..942 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:15 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 1..789 154..942 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:38 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 1..789 154..942 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:58 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 1..789 154..942 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:49:14 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 1..789 154..942 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:17 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 52..1158 1..1107 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:15 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 52..1158 1..1107 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:38 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 52..1158 1..1107 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:13:59 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 52..1158 1..1107 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:49:14 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
CG4691-RA 52..1158 1..1107 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:50:02 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14760818..14761924 1..1107 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:50:02 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14760818..14761924 1..1107 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:50:02 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14760818..14761924 1..1107 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:38 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14760818..14761924 1..1107 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:46:51 Download gff for GH20441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14760818..14761924 1..1107 100   Plus

GH20441.pep Sequence

Translation from 153 to 941

> GH20441.pep
MLAKSKPLIGMSHLLQKQVLGFLPPSSFRHFNSEGNLYSQDGWESGYPAP
LLPRKDLKPLEKKDRSKVYDACWQTTRRTEYKCRSDPEFQMHAFIDSRKS
CLEDPCATEMLAIDLTHYKPSDMGKRKYPRTWFECVVKRRKRKAHCVPVP
PPMPRRKRKSKKPRCPEDLCVLGKLELNLIKPCVKESSKCPRFRMPNCCV
AARDPPKCRRPFRRCGQRPKTKYPSFSECRRDPFPDPRPIECNCLLKPAI
CDMWRHYRRRFG*

GH20441.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14894-PA 253 GF14894-PA 1..250 1..262 614 56.2 Plus
Dana\GF19807-PA 244 GF19807-PA 2..240 14..258 358 38.6 Plus
Dana\GF12592-PA 303 GF12592-PA 144..291 113..262 188 34.8 Plus
Dana\GF12352-PA 229 GF12352-PA 49..217 85..262 180 37 Plus
Dana\GF13521-PA 277 GF13521-PA 103..260 104..262 171 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25129-PA 248 GG25129-PA 1..248 1..262 1131 85.1 Plus
Dere\GG10650-PA 256 GG10650-PA 34..252 41..258 405 46.4 Plus
Dere\GG23352-PA 244 GG23352-PA 69..232 89..262 233 37.5 Plus
Dere\GG22409-PA 239 GG22409-PA 42..237 57..260 176 31.8 Plus
Dere\GG10647-PA 303 GG10647-PA 146..291 114..262 164 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20818-PA 177 GH20818-PA 1..175 90..260 274 42.2 Plus
Dgri\GH20817-PA 240 GH20817-PA 83..228 103..262 171 36.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG4691-PA 262 CG4691-PA 1..262 1..262 1478 100 Plus
boly-PA 255 CG30362-PA 33..253 41..260 487 47.3 Plus
CG8701-PA 246 CG8701-PA 64..231 84..259 272 35.7 Plus
CG2127-PB 289 CG2127-PB 130..275 114..260 252 39.5 Plus
CG2127-PA 305 CG2127-PA 146..291 114..260 252 39.5 Plus
CG12861-PA 239 CG12861-PA 34..237 52..260 245 31.7 Plus
CG33340-PA 229 CG33340-PA 87..224 114..260 222 39.6 Plus
hubl-PB 291 CG30364-PB 132..274 114..258 200 38.7 Plus
hubl-PA 291 CG30364-PA 132..274 114..258 200 38.7 Plus
CG12860-PA 316 CG12860-PA 150..297 104..256 184 33.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20915-PA 272 GI20915-PA 43..270 35..260 453 46.8 Plus
Dmoj\GI20912-PA 250 GI20912-PA 81..238 99..262 166 34.3 Plus
Dmoj\GI20909-PA 248 GI20909-PA 68..234 89..261 143 33.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10869-PA 261 GL10869-PA 9..259 18..260 425 41.5 Plus
Dper\GL10866-PA 259 GL10866-PA 102..247 114..262 173 39.4 Plus
Dper\GL11217-PA 243 GL11217-PA 67..227 88..259 144 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:22:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15789-PA 261 GA15789-PA 9..259 18..260 428 41.5 Plus
Dpse\GA11864-PA 216 GA11864-PA 34..213 76..261 187 38.3 Plus
Dpse\GA15259-PA 259 GA15259-PA 102..247 114..262 173 39.4 Plus
Dpse\GA21267-PA 243 GA21267-PA 67..227 88..259 144 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15754-PA 262 GM15754-PA 1..262 1..262 1220 95 Plus
Dsec\GM20695-PA 252 GM20695-PA 33..248 41..258 421 48.2 Plus
Dsec\GM21027-PA 246 GM21027-PA 64..234 84..262 205 34.1 Plus
Dsec\GM20692-PA 305 GM20692-PA 146..293 114..262 201 39 Plus
Dsec\GM20195-PA 239 GM20195-PA 43..237 63..260 167 29.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23976-PA 262 GD23976-PA 1..262 1..262 1225 95.4 Plus
Dsim\GD15278-PA 252 GD15278-PA 33..248 41..258 419 47.7 Plus
Dsim\GD15275-PA 305 GD15275-PA 146..293 114..262 198 39 Plus
Dsim\GD25666-PA 239 GD25666-PA 43..239 63..262 167 29.5 Plus
Dsim\GD21095-PA 232 GD21095-PA 89..227 113..260 152 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20645-PA 276 GJ20645-PA 31..274 9..260 451 46.2 Plus
Dvir\GJ20644-PA 206 GJ20644-PA 1..204 60..260 450 50 Plus
Dvir\GJ20641-PA 249 GJ20641-PA 81..237 99..262 182 37.4 Plus
Dvir\GJ23810-PA 238 GJ23810-PA 92..231 113..260 152 36.5 Plus
Dvir\GJ20646-PA 263 GJ20646-PA 100..237 110..259 147 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15755-PA 265 GK15755-PA 2..263 11..260 511 46.2 Plus
Dwil\GK15752-PA 216 GK15752-PA 42..201 89..258 199 37.1 Plus
Dwil\GK19521-PA 232 GK19521-PA 53..230 75..260 187 33.7 Plus
Dwil\GK15825-PA 289 GK15825-PA 132..277 114..262 173 39.2 Plus
Dwil\GK19110-PA 237 GK19110-PA 91..230 113..260 143 36.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19047-PA 239 GE19047-PA 1..239 11..262 1047 86.1 Plus
Dyak\GE23091-PA 256 GE23091-PA 2..252 14..258 396 43.3 Plus
Dyak\GE19192-PA 245 GE19192-PA 64..234 84..262 224 36.6 Plus
Dyak\GE23064-PA 307 GE23064-PA 148..295 114..262 202 40.3 Plus
Dyak\GE12298-PA 239 GE12298-PA 43..237 63..260 164 30.6 Plus

GH20441.hyp Sequence

Translation from 153 to 941

> GH20441.hyp
MLAKSKPLIGMSHLLQKQVLGFLPPSSFRHFNSEGNLYSQDGWESGYPAP
LLPRKDLKPLEKKDRSKVYDACWQTTRRTEYKCRSDPEFQMHAFIDSRKS
CLEDPCATEMLAIDLTHYKPSDMGKRKYPRTWFECVVKRRKRKAHCVPVP
PPMPRRKRKSKKPRCPEDLCVLGKLELNLIKPCVKESSKCPRFRMPNCCV
AARDPPKCRRPFRRCGQRPKTKYPSFSECRRDPFPDPRPIECNCLLKPAI
CDMWRHYRRRFG*

GH20441.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG4691-PA 262 CG4691-PA 1..262 1..262 1478 100 Plus
boly-PA 255 CG30362-PA 33..253 41..260 487 47.3 Plus
CG8701-PA 246 CG8701-PA 64..231 84..259 272 35.7 Plus
CG2127-PB 289 CG2127-PB 130..275 114..260 252 39.5 Plus
CG2127-PA 305 CG2127-PA 146..291 114..260 252 39.5 Plus