Clone GH20534 Report

Search the DGRC for GH20534

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:205
Well:34
Vector:pOT2
Associated Gene/TranscriptCG17472-RA
Protein status:GH20534.pep: gold
Preliminary Size:546
Sequenced Size:561

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17472 2002-01-01 Sim4 clustering to Release 2
CG17472 2002-05-18 Blastp of sequenced clone
CG17472 2003-01-01 Sim4 clustering to Release 3
CG17472 2008-04-29 Release 5.5 accounting
CG17472 2008-08-15 Release 5.9 accounting
CG17472 2008-12-18 5.12 accounting

Clone Sequence Records

GH20534.complete Sequence

561 bp (561 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118805

> GH20534.complete
TTAGCGGAATGAAGATAATAGCACTCTTAGTATTGGCGAATCTGGGCTTT
GCCCTTAGTAGTAAGGAATATGATGAACACGAAAGGCTGGTGACGTGGAG
ACTTCGAAATATTGTAAACAAGTATAAATACTTAGCCACCGGAAACGCGG
AGTTCTCCCGGTGGATTGAAAAAGTAAACAACGCTGCTGCCCGAAGTAAC
CTTGAAGTAAAGTTGGACACAGAAGGTTACTTCAAAGTATACGATGAACA
ACGCCAATTGCTTGAAGATAACATTACTCAGCGCTTGAACACGCTCAGAT
CCCTAATATCATTAAGAAAAGGAGGCAAGAGATGTGTCCGATTCTACCAG
CATCAGGAAAATGAACTTAAGAATGCCTACAAGTTCTCTAATCAGAAAAA
AGAAGAGGTGTTTGTGAATAGTTTGAAGAAATGCTTTGCACCACCGGCGA
TACAAGAATATGATTATGATTACTATCTAGGCTATTGATCATTAAATTGT
CCAATGAAATCGAATAAAAGCTCGCTTTTGGTTAACCTTTAAAAAAAAAA
AAAAAAAAAAA

GH20534.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG17472-RA 558 CG17472-RA 12..552 1..541 2705 100 Plus
CG31680-RA 502 CG31680-RA 218..366 261..409 265 78.5 Plus
CG31680-RA 502 CG31680-RA 77..180 84..187 250 82.6 Plus
CG31680-RA 502 CG31680-RA 1..47 5..51 235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20633122..20633611 51..540 2450 100 Plus
chr2L 23010047 chr2L 20637586..20637832 51..311 895 90.4 Plus
chr2L 23010047 chr2L 20637829..20638017 352..540 705 91.5 Plus
chr2L 23010047 chr2L 20638873..20639021 261..409 265 78.5 Plus
chr2L 23010047 chr2L 20633001..20633051 1..51 255 100 Plus
chr2L 23010047 chr2L 20638732..20638835 84..187 250 82.7 Plus
chr2L 23010047 chr2L 20638581..20638631 1..51 240 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:00:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20634678..20635168 51..541 2455 100 Plus
2L 23513712 2L 20639136..20639378 51..307 845 89.5 Plus
2L 23513712 2L 20639385..20639579 347..541 720 91.3 Plus
2L 23513712 2L 20640434..20640582 261..409 265 78.5 Plus
2L 23513712 2L 20634557..20634607 1..51 255 100 Plus
2L 23513712 2L 20640142..20640192 1..51 255 100 Plus
2L 23513712 2L 20640293..20640396 84..187 250 82.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20634678..20635168 51..541 2455 100 Plus
2L 23513712 2L 20639385..20639579 347..541 720 91.2 Plus
2L 23513712 2L 20639136..20639276 51..191 615 95.7 Plus
2L 23513712 2L 20639284..20639378 213..307 430 96.8 Plus
2L 23513712 2L 20640434..20640582 261..409 265 78.5 Plus
2L 23513712 2L 20634557..20634607 1..51 255 100 Plus
2L 23513712 2L 20640142..20640192 1..51 255 100 Plus
2L 23513712 2L 20640293..20640396 84..187 250 82.6 Plus
2L 23513712 2L 20639015..20639062 1..48 165 89.5 Plus
Blast to na_te.dros performed on 2019-03-16 01:05:09 has no hits.

GH20534.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:05:57 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20633001..20633051 1..51 100 -> Plus
chr2L 20633123..20633611 52..540 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:29 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..480 9..488 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:08 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..480 9..488 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:42 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..480 9..488 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:23 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..480 9..488 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:22:32 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..480 9..488 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:41 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:07 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:42 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 43..582 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:24 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 1..536 1..536 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:22:32 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
CG17472-RA 43..582 1..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:57 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20634557..20634607 1..51 100 -> Plus
2L 20634679..20635167 52..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:57 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20634557..20634607 1..51 100 -> Plus
2L 20634679..20635167 52..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:57 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20634557..20634607 1..51 100 -> Plus
2L 20634679..20635167 52..540 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:42 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20634557..20634607 1..51 100 -> Plus
arm_2L 20634679..20635167 52..540 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:46 Download gff for GH20534.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20634679..20635167 52..540 100   Plus
2L 20634557..20634607 1..51 100 -> Plus

GH20534.hyp Sequence

Translation from 2 to 487

> GH20534.hyp
SGMKIIALLVLANLGFALSSKEYDEHERLVTWRLRNIVNKYKYLATGNAE
FSRWIEKVNNAAARSNLEVKLDTEGYFKVYDEQRQLLEDNITQRLNTLRS
LISLRKGGKRCVRFYQHQENELKNAYKFSNQKKEEVFVNSLKKCFAPPAI
QEYDYDYYLGY*

GH20534.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG17472-PA 159 CG17472-PA 1..159 3..161 827 100 Plus
CG31680-PA 147 CG31680-PA 1..129 3..144 363 53.5 Plus
Sfp38D-PB 169 CG42606-PB 1..146 3..144 232 36.1 Plus
Sfp38D-PA 169 CG42606-PA 1..146 3..144 232 36.1 Plus
CG43074-PA 182 CG43074-PA 47..181 23..159 166 29.5 Plus

GH20534.pep Sequence

Translation from 8 to 487

> GH20534.pep
MKIIALLVLANLGFALSSKEYDEHERLVTWRLRNIVNKYKYLATGNAEFS
RWIEKVNNAAARSNLEVKLDTEGYFKVYDEQRQLLEDNITQRLNTLRSLI
SLRKGGKRCVRFYQHQENELKNAYKFSNQKKEEVFVNSLKKCFAPPAIQE
YDYDYYLGY*

GH20534.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21961-PA 172 GF21961-PA 21..143 22..142 168 35.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21241-PA 160 GG21241-PA 1..156 1..156 494 62.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17472-PA 159 CG17472-PA 1..159 1..159 827 100 Plus
CG31680-PA 147 CG31680-PA 1..129 1..142 363 53.5 Plus
Sfp38D-PB 169 CG42606-PB 1..146 1..142 232 36.1 Plus
Sfp38D-PA 169 CG42606-PA 1..146 1..142 232 36.1 Plus
CG43074-PA 182 CG43074-PA 47..181 21..157 166 29.5 Plus
CG43090-PA 169 CG43090-PA 4..144 3..142 162 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26166-PA 181 GL26166-PA 47..153 28..132 152 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14521-PA 167 GA14521-PA 33..139 28..132 159 38.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23355-PA 160 GM23355-PA 1..150 1..149 610 78 Plus
Dsec\GM23356-PA 159 GM23356-PA 1..149 1..149 607 76.5 Plus
Dsec\GM23357-PA 147 GM23357-PA 1..129 1..142 364 54.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24265-PA 159 GD24265-PA 1..149 1..149 615 77.2 Plus
Dsim\GD24269-PA 159 GD24269-PA 1..149 1..149 607 76.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13314-PA 163 GE13314-PA 1..142 1..142 506 66.2 Plus