GH20534.complete Sequence
561 bp (561 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118805
> GH20534.complete
TTAGCGGAATGAAGATAATAGCACTCTTAGTATTGGCGAATCTGGGCTTT
GCCCTTAGTAGTAAGGAATATGATGAACACGAAAGGCTGGTGACGTGGAG
ACTTCGAAATATTGTAAACAAGTATAAATACTTAGCCACCGGAAACGCGG
AGTTCTCCCGGTGGATTGAAAAAGTAAACAACGCTGCTGCCCGAAGTAAC
CTTGAAGTAAAGTTGGACACAGAAGGTTACTTCAAAGTATACGATGAACA
ACGCCAATTGCTTGAAGATAACATTACTCAGCGCTTGAACACGCTCAGAT
CCCTAATATCATTAAGAAAAGGAGGCAAGAGATGTGTCCGATTCTACCAG
CATCAGGAAAATGAACTTAAGAATGCCTACAAGTTCTCTAATCAGAAAAA
AGAAGAGGTGTTTGTGAATAGTTTGAAGAAATGCTTTGCACCACCGGCGA
TACAAGAATATGATTATGATTACTATCTAGGCTATTGATCATTAAATTGT
CCAATGAAATCGAATAAAAGCTCGCTTTTGGTTAACCTTTAAAAAAAAAA
AAAAAAAAAAA
GH20534.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:04:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17472-RA | 558 | CG17472-RA | 12..552 | 1..541 | 2705 | 100 | Plus |
CG31680-RA | 502 | CG31680-RA | 218..366 | 261..409 | 265 | 78.5 | Plus |
CG31680-RA | 502 | CG31680-RA | 77..180 | 84..187 | 250 | 82.6 | Plus |
CG31680-RA | 502 | CG31680-RA | 1..47 | 5..51 | 235 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:05:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 20633122..20633611 | 51..540 | 2450 | 100 | Plus |
chr2L | 23010047 | chr2L | 20637586..20637832 | 51..311 | 895 | 90.4 | Plus |
chr2L | 23010047 | chr2L | 20637829..20638017 | 352..540 | 705 | 91.5 | Plus |
chr2L | 23010047 | chr2L | 20638873..20639021 | 261..409 | 265 | 78.5 | Plus |
chr2L | 23010047 | chr2L | 20633001..20633051 | 1..51 | 255 | 100 | Plus |
chr2L | 23010047 | chr2L | 20638732..20638835 | 84..187 | 250 | 82.7 | Plus |
chr2L | 23010047 | chr2L | 20638581..20638631 | 1..51 | 240 | 98 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:00:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 20634678..20635168 | 51..541 | 2455 | 100 | Plus |
2L | 23513712 | 2L | 20639136..20639378 | 51..307 | 845 | 89.5 | Plus |
2L | 23513712 | 2L | 20639385..20639579 | 347..541 | 720 | 91.3 | Plus |
2L | 23513712 | 2L | 20640434..20640582 | 261..409 | 265 | 78.5 | Plus |
2L | 23513712 | 2L | 20634557..20634607 | 1..51 | 255 | 100 | Plus |
2L | 23513712 | 2L | 20640142..20640192 | 1..51 | 255 | 100 | Plus |
2L | 23513712 | 2L | 20640293..20640396 | 84..187 | 250 | 82.7 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 20634678..20635168 | 51..541 | 2455 | 100 | Plus |
2L | 23513712 | 2L | 20639385..20639579 | 347..541 | 720 | 91.2 | Plus |
2L | 23513712 | 2L | 20639136..20639276 | 51..191 | 615 | 95.7 | Plus |
2L | 23513712 | 2L | 20639284..20639378 | 213..307 | 430 | 96.8 | Plus |
2L | 23513712 | 2L | 20640434..20640582 | 261..409 | 265 | 78.5 | Plus |
2L | 23513712 | 2L | 20634557..20634607 | 1..51 | 255 | 100 | Plus |
2L | 23513712 | 2L | 20640142..20640192 | 1..51 | 255 | 100 | Plus |
2L | 23513712 | 2L | 20640293..20640396 | 84..187 | 250 | 82.6 | Plus |
2L | 23513712 | 2L | 20639015..20639062 | 1..48 | 165 | 89.5 | Plus |
Blast to na_te.dros performed on 2019-03-16 01:05:09 has no hits.
GH20534.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:05:57 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 20633001..20633051 | 1..51 | 100 | -> | Plus |
chr2L | 20633123..20633611 | 52..540 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:29 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..480 | 9..488 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:08 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..480 | 9..488 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:42 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..480 | 9..488 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:23 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..480 | 9..488 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:22:32 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..480 | 9..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:21:41 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..536 | 1..536 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:07 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..536 | 1..536 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:42 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 43..582 | 1..540 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:24 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 1..536 | 1..536 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:22:32 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17472-RA | 43..582 | 1..540 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:57 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20634557..20634607 | 1..51 | 100 | -> | Plus |
2L | 20634679..20635167 | 52..540 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:57 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20634557..20634607 | 1..51 | 100 | -> | Plus |
2L | 20634679..20635167 | 52..540 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:57 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20634557..20634607 | 1..51 | 100 | -> | Plus |
2L | 20634679..20635167 | 52..540 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:42 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 20634557..20634607 | 1..51 | 100 | -> | Plus |
arm_2L | 20634679..20635167 | 52..540 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:10:46 Download gff for
GH20534.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 20634679..20635167 | 52..540 | 100 | | Plus |
2L | 20634557..20634607 | 1..51 | 100 | -> | Plus |
GH20534.hyp Sequence
Translation from 2 to 487
> GH20534.hyp
SGMKIIALLVLANLGFALSSKEYDEHERLVTWRLRNIVNKYKYLATGNAE
FSRWIEKVNNAAARSNLEVKLDTEGYFKVYDEQRQLLEDNITQRLNTLRS
LISLRKGGKRCVRFYQHQENELKNAYKFSNQKKEEVFVNSLKKCFAPPAI
QEYDYDYYLGY*
GH20534.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:19:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17472-PA | 159 | CG17472-PA | 1..159 | 3..161 | 827 | 100 | Plus |
CG31680-PA | 147 | CG31680-PA | 1..129 | 3..144 | 363 | 53.5 | Plus |
Sfp38D-PB | 169 | CG42606-PB | 1..146 | 3..144 | 232 | 36.1 | Plus |
Sfp38D-PA | 169 | CG42606-PA | 1..146 | 3..144 | 232 | 36.1 | Plus |
CG43074-PA | 182 | CG43074-PA | 47..181 | 23..159 | 166 | 29.5 | Plus |
GH20534.pep Sequence
Translation from 8 to 487
> GH20534.pep
MKIIALLVLANLGFALSSKEYDEHERLVTWRLRNIVNKYKYLATGNAEFS
RWIEKVNNAAARSNLEVKLDTEGYFKVYDEQRQLLEDNITQRLNTLRSLI
SLRKGGKRCVRFYQHQENELKNAYKFSNQKKEEVFVNSLKKCFAPPAIQE
YDYDYYLGY*
GH20534.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:58:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF21961-PA | 172 | GF21961-PA | 21..143 | 22..142 | 168 | 35.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:58:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21241-PA | 160 | GG21241-PA | 1..156 | 1..156 | 494 | 62.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17472-PA | 159 | CG17472-PA | 1..159 | 1..159 | 827 | 100 | Plus |
CG31680-PA | 147 | CG31680-PA | 1..129 | 1..142 | 363 | 53.5 | Plus |
Sfp38D-PB | 169 | CG42606-PB | 1..146 | 1..142 | 232 | 36.1 | Plus |
Sfp38D-PA | 169 | CG42606-PA | 1..146 | 1..142 | 232 | 36.1 | Plus |
CG43074-PA | 182 | CG43074-PA | 47..181 | 21..157 | 166 | 29.5 | Plus |
CG43090-PA | 169 | CG43090-PA | 4..144 | 3..142 | 162 | 32.4 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:58:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26166-PA | 181 | GL26166-PA | 47..153 | 28..132 | 152 | 37.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:58:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA14521-PA | 167 | GA14521-PA | 33..139 | 28..132 | 159 | 38.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:58:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23355-PA | 160 | GM23355-PA | 1..150 | 1..149 | 610 | 78 | Plus |
Dsec\GM23356-PA | 159 | GM23356-PA | 1..149 | 1..149 | 607 | 76.5 | Plus |
Dsec\GM23357-PA | 147 | GM23357-PA | 1..129 | 1..142 | 364 | 54.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:58:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24265-PA | 159 | GD24265-PA | 1..149 | 1..149 | 615 | 77.2 | Plus |
Dsim\GD24269-PA | 159 | GD24269-PA | 1..149 | 1..149 | 607 | 76.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:58:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13314-PA | 163 | GE13314-PA | 1..142 | 1..142 | 506 | 66.2 | Plus |