Clone GH20621 Report

Search the DGRC for GH20621

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:206
Well:21
Vector:pOT2
Associated Gene/TranscriptCG5945-RA
Protein status:GH20621.pep: gold
Preliminary Size:925
Sequenced Size:928

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5945 2002-01-01 Sim4 clustering to Release 2
CG5945 2002-06-13 Blastp of sequenced clone
CG5945 2003-01-01 Sim4 clustering to Release 3
CG5945 2008-04-29 Release 5.5 accounting
CG5945 2008-08-15 Release 5.9 accounting
CG5945 2008-12-18 5.12 accounting

Clone Sequence Records

GH20621.complete Sequence

928 bp (928 high quality bases) assembled on 2002-06-13

GenBank Submission: AY122123

> GH20621.complete
TTCTAGCAGTAGGTTGAAAGTCGAATTCGAGTCCCAAAAAGGATATAGTT
TAGTAGTAGAATGTATTGTACTATTGGATTGCTCAGCCTGCTGGCCTTGG
GATGCAGTGCAGCTCCCACGGATAAAAACTACTTTGCTGATTTGCCAAAA
TGCTCGACTGAAGAGGATCAGCTGGGTGAGTGCGTGAAGCAGCTGTTTAA
CACATTGACTCCGCGCCTCAAGGACGGTAATCCAGAGTTGAGAATCGAGC
CCTACGAACCTTTGCACCTCAACCGAACCAGCTTCCAATACTCTAGTGGC
ACTGTCAATGGTCGCATCACCGTTCGCAATGCCAAGATTTATGGCTTCTC
CTCCAATCGGGCCAAAGAGGTGTCCGTCAAACTCAATGGCGACAAGGTGA
AACTCCGTCTGGTCACCCAAATGCCCAAGTTGAACATTGTGGGCAGCTAT
AAGGCCGACATGCAGGTGAATCAGCTGCAACTGAAGCCCAAGGGTGAATT
CAACGTAACGCTCTTGGATGTGGAGGCCATAACGGTGACCGATGGTGAGG
TCTACGAGAAGGATGGTCATCGGTTTTTCCGCCTCAAGAATATCGACTCA
AAGCCAAAGATCAAGGACTTGGTTATCAAGGCAAACGGAATATTTGCAGA
TCCTGAACTGGATAAAATCGCTCTGAATGTGGCTAATCAGTATTGGCGCG
ATATTTACGGAATAATGTTGCCTGAGACTCGACAGTTTTGGCAACCCCTT
ATGTTGCGAATGTTCAACGAGGCATTCGAACTAGTTCCCATCGACCAGTT
TCTCAAGGAGTAGCTCAATTTGCGGTTGGATTTAATAGAATGATGATGGT
TAAATAGAAAATAAATTTTTCCATTAGGTGCTATTAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH20621.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG5945-RA 1082 CG5945-RA 151..1038 1..888 4440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13238996..13239371 139..514 1865 99.7 Plus
chr2L 23010047 chr2L 13240164..13240388 661..885 1125 100 Plus
chr2L 23010047 chr2L 13239424..13239570 515..661 735 100 Plus
chr2L 23010047 chr2L 13238798..13238936 1..139 695 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:00:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13240335..13240710 139..514 1880 100 Plus
2L 23513712 2L 13241503..13241730 661..888 1140 100 Plus
2L 23513712 2L 13240763..13240909 515..661 735 100 Plus
2L 23513712 2L 13240137..13240275 1..139 695 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13240335..13240710 139..514 1880 100 Plus
2L 23513712 2L 13241503..13241730 661..888 1140 100 Plus
2L 23513712 2L 13240763..13240909 515..661 735 100 Plus
2L 23513712 2L 13240137..13240275 1..139 695 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:12:23 has no hits.

GH20621.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:13:21 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13239424..13239570 515..661 100 -> Plus
chr2L 13238798..13238936 1..139 100 -> Plus
chr2L 13238997..13239371 140..514 99 -> Plus
chr2L 13240165..13240388 662..885 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:50:36 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 1..753 61..813 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:21:52 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 1..753 61..813 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:48:57 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 1..753 61..813 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:41 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 1..753 61..813 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:01:23 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 1..753 61..813 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:48:11 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 5..889 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:21:52 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 5..889 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:48:57 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 19..903 1..885 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:42 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 5..889 1..885 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:01:23 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
CG5945-RA 19..903 1..885 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:21 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13240763..13240909 515..661 100 -> Plus
2L 13241504..13241727 662..885 100   Plus
2L 13240336..13240710 140..514 100 -> Plus
2L 13240137..13240275 1..139 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:21 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13240763..13240909 515..661 100 -> Plus
2L 13241504..13241727 662..885 100   Plus
2L 13240336..13240710 140..514 100 -> Plus
2L 13240137..13240275 1..139 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:21 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13240763..13240909 515..661 100 -> Plus
2L 13241504..13241727 662..885 100   Plus
2L 13240336..13240710 140..514 100 -> Plus
2L 13240137..13240275 1..139 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:48:57 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13240137..13240275 1..139 100 -> Plus
arm_2L 13240336..13240710 140..514 100 -> Plus
arm_2L 13240763..13240909 515..661 100 -> Plus
arm_2L 13241504..13241727 662..885 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:23 Download gff for GH20621.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13240336..13240710 140..514 100 -> Plus
2L 13240763..13240909 515..661 100 -> Plus
2L 13241504..13241727 662..885 100   Plus
2L 13240137..13240275 1..139 100 -> Plus

GH20621.hyp Sequence

Translation from 60 to 812

> GH20621.hyp
MYCTIGLLSLLALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLT
PRLKDGNPELRIEPYEPLHLNRTSFQYSSGTVNGRITVRNAKIYGFSSNR
AKEVSVKLNGDKVKLRLVTQMPKLNIVGSYKADMQVNQLQLKPKGEFNVT
LLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKIKDLVIKANGIFADPEL
DKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQFLKE
*

GH20621.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5945-PB 250 CG5945-PB 1..250 1..250 1301 100 Plus
CG5945-PA 250 CG5945-PA 1..250 1..250 1301 100 Plus
CG5867-PA 262 CG5867-PA 38..259 27..248 506 39.6 Plus
CG16820-PA 309 CG16820-PA 84..307 27..248 351 30.8 Plus
CG10407-PB 259 CG10407-PB 38..222 28..213 199 27.3 Plus

GH20621.pep Sequence

Translation from 60 to 812

> GH20621.pep
MYCTIGLLSLLALGCSAAPTDKNYFADLPKCSTEEDQLGECVKQLFNTLT
PRLKDGNPELRIEPYEPLHLNRTSFQYSSGTVNGRITVRNAKIYGFSSNR
AKEVSVKLNGDKVKLRLVTQMPKLNIVGSYKADMQVNQLQLKPKGEFNVT
LLDVEAITVTDGEVYEKDGHRFFRLKNIDSKPKIKDLVIKANGIFADPEL
DKIALNVANQYWRDIYGIMLPETRQFWQPLMLRMFNEAFELVPIDQFLKE
*

GH20621.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23101-PA 255 GF23101-PA 1..255 1..250 1034 77.3 Plus
Dana\GF23097-PA 260 GF23097-PA 35..259 26..250 505 39.1 Plus
Dana\GF23102-PA 315 GF23102-PA 94..313 31..248 357 31.8 Plus
Dana\GF11323-PA 261 GF11323-PA 40..233 31..233 180 24.6 Plus
Dana\GF18921-PA 246 GF18921-PA 6..243 3..247 173 23.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23829-PA 250 GG23829-PA 1..250 1..250 1268 92.8 Plus
Dere\GG23828-PA 262 GG23828-PA 10..259 8..248 512 37.2 Plus
Dere\GG23830-PA 307 GG23830-PA 86..305 31..248 361 31.8 Plus
Dere\GG20212-PA 259 GG20212-PA 41..234 31..233 187 26.1 Plus
Dere\GG11299-PA 251 GG11299-PA 6..249 7..248 176 24 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25092-PA 259 GH25092-PA 2..256 1..249 766 54.9 Plus
Dgri\GH25091-PA 265 GH25091-PA 40..259 26..245 545 41.8 Plus
Dgri\GH25093-PA 283 GH25093-PA 71..281 40..248 331 32.2 Plus
Dgri\GH18842-PA 260 GH18842-PA 39..255 31..248 191 23.7 Plus
Dgri\GH16705-PA 271 GH16705-PA 5..255 5..250 180 23.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5945-PB 250 CG5945-PB 1..250 1..250 1301 100 Plus
CG5945-PA 250 CG5945-PA 1..250 1..250 1301 100 Plus
CG5867-PA 262 CG5867-PA 38..259 27..248 506 39.6 Plus
CG16820-PA 309 CG16820-PA 84..307 27..248 351 30.8 Plus
CG10407-PB 259 CG10407-PB 38..222 28..213 199 27.3 Plus
CG10407-PA 259 CG10407-PA 38..222 28..213 199 27.3 Plus
CG13618-PA 252 CG13618-PA 33..247 29..245 189 24 Plus
CG10407-PC 263 CG10407-PC 38..226 28..213 188 26.7 Plus
CG15497-PA 260 CG15497-PA 26..258 11..248 170 24 Plus
CG2650-PA 260 CG2650-PA 13..259 5..250 168 23.2 Plus
CG14259-PA 289 CG14259-PA 16..271 6..250 162 20.9 Plus
CG1124-PA 246 CG1124-PA 25..243 28..247 161 21 Plus
CG17189-PC 271 CG17189-PC 4..255 5..250 154 21.3 Plus
CG17189-PB 271 CG17189-PB 4..255 5..250 154 21.3 Plus
CG2016-PD 249 CG2016-PD 10..246 10..248 146 21.2 Plus
CG2016-PB 249 CG2016-PB 10..246 10..248 146 21.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17614-PA 255 GI17614-PA 3..252 2..249 839 59.6 Plus
Dmoj\GI17613-PA 255 GI17613-PA 3..252 2..249 704 49.6 Plus
Dmoj\GI17612-PA 264 GI17612-PA 40..263 27..250 556 42 Plus
Dmoj\GI17615-PA 281 GI17615-PA 54..281 25..250 351 31.1 Plus
Dmoj\GI10103-PA 293 GI10103-PA 46..255 7..215 202 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26315-PA 253 GL26315-PA 1..253 1..250 1098 79.4 Plus
Dper\GL26314-PA 263 GL26314-PA 38..260 26..248 518 39.9 Plus
Dper\GL26316-PA 318 GL26316-PA 97..316 31..248 348 32.3 Plus
Dper\GL21869-PA 240 GL21869-PA 20..238 28..248 192 24.4 Plus
Dper\GL21627-PA 246 GL21627-PA 6..243 3..247 188 24.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19250-PA 253 GA19250-PA 1..253 1..250 1089 78.7 Plus
Dpse\GA19190-PA 263 GA19190-PA 38..260 26..248 517 39.9 Plus
Dpse\GA14166-PA 320 GA14166-PA 99..318 31..248 348 32.3 Plus
Dpse\GA12411-PA 253 GA12411-PA 33..248 28..245 192 24.8 Plus
Dpse\GA10858-PA 246 GA10858-PA 6..243 3..247 188 24.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10322-PA 250 GM10322-PA 1..250 1..250 1307 97.6 Plus
Dsec\GM10311-PA 262 GM10311-PA 10..259 8..248 511 37.2 Plus
Dsec\GM10333-PA 311 GM10333-PA 90..311 31..250 356 30.6 Plus
Dsec\GM22927-PA 137 GM22927-PA 1..136 115..250 326 41.9 Plus
Dsec\GM25738-PA 230 GM25738-PA 12..205 31..233 194 27.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23879-PA 250 GD23879-PA 1..250 1..250 1311 98 Plus
Dsim\GD23877-PA 262 GD23877-PA 10..259 8..248 512 37.2 Plus
Dsim\GD23880-PA 311 GD23880-PA 90..311 31..250 357 31.1 Plus
Dsim\GD19433-PA 260 GD19433-PA 19..258 8..248 173 23.7 Plus
Dsim\GD19757-PA 246 GD19757-PA 27..243 30..247 161 21.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17958-PA 255 GJ17958-PA 3..251 2..248 858 61.4 Plus
Dvir\GJ17957-PA 264 GJ17957-PA 40..258 27..245 520 39.7 Plus
Dvir\GJ17959-PA 281 GJ17959-PA 56..279 27..248 372 33 Plus
Dvir\GJ23840-PA 260 GJ23840-PA 14..255 8..248 203 25.6 Plus
Dvir\GJ23820-PA 254 GJ23820-PA 33..252 27..248 181 23.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14552-PA 254 GK14552-PA 1..254 1..250 897 67.3 Plus
Dwil\GK14551-PA 265 GK14551-PA 40..262 26..248 517 41.3 Plus
Dwil\GK14554-PA 317 GK14554-PA 96..315 31..248 354 32.7 Plus
Dwil\GK14019-PA 258 GK14019-PA 37..253 31..248 190 24.7 Plus
Dwil\GK11044-PA 258 GK11044-PA 25..256 24..250 174 25.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18633-PA 250 GE18633-PA 1..250 1..250 1172 90.8 Plus
Dyak\GE18631-PA 262 GE18631-PA 5..259 5..248 502 34.9 Plus
Dyak\GE18634-PA 311 GE18634-PA 90..309 31..248 360 31.8 Plus
Dyak\GE26341-PA 259 GE26341-PA 41..234 31..233 188 26.1 Plus
Dyak\GE23494-PA 251 GE23494-PA 6..249 7..248 178 24 Plus